DPGLEAN21125 in OGS1.0

New model in OGS2.0DPOGS200006 
Genomic Positionscaffold2214:- 19691-33556
See gene structure
CDS Length1830
Paired RNAseq reads  1253
Single RNAseq reads  3221
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA009724 (0.0)
Best Drosophila hit  CG6499 (0.0)
Best Human hitND
Best NR hit (blastp)  GK12090 [Drosophila willistoni] (0.0)
Best NR hit (blastx)  GA19641 [Drosophila pseudoobscura pseudoobscura] (0.0)
GeneOntology terms

  
GO:0008519 ammonium transmembrane transporter activity
GO:0055085 transmembrane transport
GO:0016020 membrane
InterPro families  IPR001905 Ammonium transporter
Orthology groupMCL16452

Nucleotide sequence:

ATGGATTCAAATTGGACTTTCCACGTTGGTCTGCGGTCACCGAACCTGACGAACACCACG
GTCAGTCTCCAGGAGAACTTCGAAATCGATCTGGAAGATACCAACTGGATCCTGACTTCA
TCGTTCATCATCTTCACGATGCAAACAGGTTTTGGTATGTTGGAGTCTGGCTGCGTGTCC
ATAAAGAACGAAGCCAACATCATGATGAAGAACCTGGCGGATATATCACTGGGCGGTCTC
ACCTATTGGATCTTCGGCTATGGCATGTCTTTCGGTGATGGGCCGTTATCGAATCCGTTC
ATCGGCGTGGGGAACTTCCTCGTGGACCCTCCGGTTGGAGACGCGCTGATGGGTCCCGTG
TTCGCATCCTTTTTATTCCAACTGTCCTTCGCCACCACGGCTACCACTATCGTCAGCGGC
GCTATGGCTGAGAGGTGTAACTTTAAAGCCTATTGTCTGTTCTCATTCCTGAACACAATA
GTGTACTGCGTGCCCGCGGGTTGGGTGTGGGGTCAGCACGGCTTTCTGAACAAACTTGGG
GCGGTGGACATCGCTGGATCGGGGCCCGTGCATCTTATTGGAGGAGCTTCAGCGTTCGCA
TCAGCTCTGATGCTGGGTCCGAGGTTGGGGAGGTACGCTCGTGGTAGCGCCCCACTACCA
CTGGGGAATCCCGTGAACGCCGTGATGGGGACGTTCGTGTTATGGTGGGGCTGGCTGGCG
TTCAACTCGGGGAGCACTTATGGGGTGAGCGGTGCTAAATGGCAATACGCAGCTCGGGCC
GCGGTGATGACAATGATGGGCTCCTTTGGAGGCGGTTTCTTTGGACTTTTATTCACGTTA
ATCAAGAACAAAGGTCGCGCTGATGTCATGGAACTCATCAACAGTGTTCTTGGTTCACTC
GTCTCTATAACAGCTGGCTGCTTCCTGTACCGAGCCTGGGAGTCTCTGGTGATCGGTATG
ATAGGAGCCGCTATCGCATCAGCGGCTACACCACTCTTCGACCGTCTAAGGATCGACGAT
CCCGTCGGGGCCTCCGCTGTTCATGGGGCCTGTGGTTTTTGGGGTGTCTTGGCTGTGGGT
CTGTTCGCTGACAATCCGATACCCATGGAAACAACTAACGGGAGATCCGGGCTTTTTAAA
GGCGGCGGTTGGTATTTGCTTGGGGTCCAGGCGCTCACCGGGGTCTGTCTGGCCGCGTGG
GGTGCTTTGGTGACGATGGCGTTGTTGTGGTTGATAGACCTCGTGTTGCCGATAAGAATG
GATCCCTATGAAGAGCTATTGGGGGCAGACCTCACCGAACATAGGATACGACATGGACAG
GTGGGTGTGACGCGAGCGGTTTCCGCCCTACGACCTTTCTATCAGTCTCCAAGTGTGGAG
CTGGTGGGGGGTGTAGGGGTCAACACTGGCCACGATCTCGTTGTGGACAAGCTTCATGAG
TACACCAGGCGGAGGAAGAACAAGCTACATCCGGAACTCCAAGTGTATCCTAACAATGGG
TTCATGGCCGACGACGAGTCCGAGCCTTCATTCAAGAACAACGGGTTCCTTAACAAAAGA
CCCGGAAATCCTGAGAACGATTTGCACAGAGCTCTGGACACCATGATCAATGAAATAGAC
GGCAGGTGTTCGAAAAGAAGAGAGACGGCTCTGAGAAAAGAAGACTTCAAGGGAAAGAAG
TTTAAGGAACTGTCTGTTCATGAGCTGGAGGAGTTAGAGGAAATCAGTGCAGCGGAAGAT
AGGTTCAGATATAGATTCACAGAAGACGATTATATTAATGACGTAGAGAGAGGCTGCTCA
GGCAACCCGACTATGAGATGGATAGACTAA

Protein sequence:

MDSNWTFHVGLRSPNLTNTTVSLQENFEIDLEDTNWILTSSFIIFTMQTGFGMLESGCVS
IKNEANIMMKNLADISLGGLTYWIFGYGMSFGDGPLSNPFIGVGNFLVDPPVGDALMGPV
FASFLFQLSFATTATTIVSGAMAERCNFKAYCLFSFLNTIVYCVPAGWVWGQHGFLNKLG
AVDIAGSGPVHLIGGASAFASALMLGPRLGRYARGSAPLPLGNPVNAVMGTFVLWWGWLA
FNSGSTYGVSGAKWQYAARAAVMTMMGSFGGGFFGLLFTLIKNKGRADVMELINSVLGSL
VSITAGCFLYRAWESLVIGMIGAAIASAATPLFDRLRIDDPVGASAVHGACGFWGVLAVG
LFADNPIPMETTNGRSGLFKGGGWYLLGVQALTGVCLAAWGALVTMALLWLIDLVLPIRM
DPYEELLGADLTEHRIRHGQVGVTRAVSALRPFYQSPSVELVGGVGVNTGHDLVVDKLHE
YTRRRKNKLHPELQVYPNNGFMADDESEPSFKNNGFLNKRPGNPENDLHRALDTMINEID
GRCSKRRETALRKEDFKGKKFKELSVHELEELEEISAAEDRFRYRFTEDDYINDVERGCS
GNPTMRWID