| New model in OGS2.0 | DPOGS212495 |
|---|---|
| Genomic Position | scaffold840:- 62605-63290 |
| See gene structure | |
| CDS Length | 348 |
| Paired RNAseq reads | 310 |
| Single RNAseq reads | 753 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA010156 (2e-52) |
| Best Drosophila hit | dynein light chain 90F (1e-26) |
| Best Human hit | dynein light chain Tctex-type 1 (2e-32) |
| Best NR hit (blastp) | PREDICTED: putative cytoplasmic dynein light chain (T-complex testis-specific protein 1 homolog) [Taeniopygia guttata] (2e-32) |
| Best NR hit (blastx) | tctex1 domain-containing protein 1 [Nasonia vitripennis] (2e-32) |
| GeneOntology terms | GO:0000132 establishment of mitotic spindle orientation GO:0003774 motor activity GO:0005515 protein binding GO:0005737 cytoplasm GO:0005794 Golgi apparatus GO:0005868 cytoplasmic dynein complex GO:0005874 microtubule GO:0006810 transport GO:0006886 intracellular protein transport GO:0007017 microtubule-based process GO:0007049 cell cycle GO:0007067 mitosis GO:0007399 nervous system development GO:0008277 regulation of G-protein coupled receptor protein signaling pathway GO:0019060 intracellular transport of viral proteins in host cell GO:0032314 regulation of Rac GTPase activity GO:0042802 identical protein binding GO:0048812 neuron projection morphogenesis GO:0050768 negative regulation of neurogenesis GO:0051301 cell division GO:0051493 regulation of cytoskeleton organization |
| InterPro families | IPR005334 Tctex-1 |
| Orthology group | MCL40504 |
Nucleotide sequence:
ATGGCACAAGAGGACGATGAAGAAGATCTAGCATTTAATGTTGAGGAAGTGCAGAAGATT
GTTAGAGATAACATTGAATTCTGCTTGGGCGGAAATGTCTACAGTCATTCACGTTGTCCA
CAATGGTTTACTATTATAACGGAAAAAACTCTGTCCAGATTAAATAAGCTAAACAAGCCT
TTTAAATACATACTCAGAATGACAATAACCCAAAAAAATGGCTCTGGACTACACACTGCA
GCCGCTTACTTTTGGGATATAGCGACGGATGGGACTTGTACAGTGCGCTGGGAAAACAAA
TATATGTATTGTATCGTTAATGTATGGGGCCTGGCGCTTCAACTTTAA
Protein sequence:
MAQEDDEEDLAFNVEEVQKIVRDNIEFCLGGNVYSHSRCPQWFTIITEKTLSRLNKLNKP
FKYILRMTITQKNGSGLHTAAAYFWDIATDGTCTVRWENKYMYCIVNVWGLALQL