| New model in OGS2.0 | DPOGS212269 |
|---|---|
| Genomic Position | scaffold187:- 58046-58889 |
| See gene structure | |
| CDS Length | 273 |
| Paired RNAseq reads | 162 |
| Single RNAseq reads | 2433 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA011581 (4e-46) |
| Best Drosophila hit | smt3 (2e-43) |
| Best Human hit | small ubiquitin-related modifier 3 precursor (3e-31) |
| Best NR hit (blastp) | ubiquitin-like protein SMT3 [Bombyx mori] (3e-45) |
| Best NR hit (blastx) | ubiquitin-like protein SMT3 [Bombyx mori] (1e-43) |
| GeneOntology terms | GO:0006464 protein modification process GO:0005515 protein binding GO:0006606 protein import into nucleus GO:0009952 anterior/posterior pattern formation GO:0006911 phagocytosis, engulfment GO:0006099 tricarboxylic acid cycle GO:0005730 nucleolus GO:0000278 mitotic cell cycle GO:0007052 mitotic spindle organization GO:0043406 positive regulation of MAP kinase activity GO:0005634 nucleus GO:0000794 condensed nuclear chromosome GO:0046579 positive regulation of Ras protein signal transduction GO:0046843 dorsal appendage formation GO:0000940 outer kinetochore of condensed chromosome GO:0000087 M phase of mitotic cell cycle GO:0030496 midbody GO:0000780 condensed nuclear chromosome, centromeric region GO:0035186 syncytial blastoderm mitotic cell cycle |
| InterPro families | IPR000626 Ubiquitin IPR022617 Small ubiquitin-related modifier, SUMO IPR019955 Ubiquitin supergroup |
| Orthology group | MCL11340 |
Nucleotide sequence:
ATGGCAGATGAAAAAAAGGGTGAAAGCGAGCACATCAACTTGAAAGTATTAGGACAGGAT
AATGCTATTGTCCAGTTCAAAATAAAGAAACACACACCTCTAAGAAAGTTGATGAATGCG
TATTGTGATCGAGCGGGTCTATCTATGCAAGTTGTTAGATTCAGATTTGATGGTCAGCCT
ATTAATGAAAACGACACACCAACATCACTTGAAATGGAAGAAGGTGACACAATAGAAGTT
TACCAGCAGCAGACGGGAGGCGTTCTAGTGTAA
Protein sequence:
MADEKKGESEHINLKVLGQDNAIVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQP
INENDTPTSLEMEEGDTIEVYQQQTGGVLV