| DPOGS202260 | ||
|---|---|---|
| Transcript | DPOGS202260-TA | 171 bp |
| Protein | DPOGS202260-PA | 56 aa |
| Genomic position | DPSCF300032 - 543757-544775 | |
| RNAseq coverage | 496266x (Rank: top 0%) | |
| Annotation | ||||
|---|---|---|---|---|
| Heliconius | HMEL005089 | 5e-22 | 72.86% | |
| Bombyx | BGIBMGA004911-TA | 4e-27 | 94.64% | |
| Drosophila | RpS29-PA | 2e-25 | 89.29% | |
| EBI UniRef50 | UniRef50_Q4LAY1 | 9e-25 | 94.64% | 40S ribosomal protein S29 n=11 Tax=Neoptera RepID=RS29_SCALT |
| NCBI RefSeq | NP_001037279.1 | 2e-25 | 94.64% | 40S ribosomal protein S29 [Bombyx mori] |
| NCBI nr blastp | gi|315115363 | 5e-25 | 98.21% | ribosomal protein S29 [Euphydryas aurinia] |
| NCBI nr blastx | gi|315115363 | 1e-27 | 98.21% | ribosomal protein S29 [Euphydryas aurinia] |
| Group | ||||
|---|---|---|---|---|
| Gene Ontology | GO:0005840 | 1.5e-20 | ribosome | |
| GO:0006412 | 1.5e-20 | translation | ||
| GO:0005622 | 1.5e-20 | intracellular | ||
| GO:0003735 | 1.5e-20 | structural constituent of ribosome | ||
| KEGG pathway | tca:659992 | 2e-23 | ||
| K02980 (RP-S29e, RPS29) | maps-> | Ribosome | ||
| InterPro domain | [5-55] IPR001209 | 1.5e-20 | Ribosomal protein S14 | |
| Orthology group | MCL12821 | Single-copy universal gene | ||
| Genotypes for resequenced monarchs and outgroup Danaus species |
|---|
>DPOGS202260-TA
ATGGGCCACGCAAACATTTGGTTTTCTCACCCACGTCGTTACGGACAGGGATCTCGCTCATGCCGAGCCTGCTCAAACAGACACGGGCTTATCCGCAAATACGGTCTGAACATTTGCCGTCAGTGCTTCAGAGAATATGCCAATGACATTGGATTCAAGAAGCTGGACTAA
>DPOGS202260-PA
MGHANIWFSHPRRYGQGSRSCRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD-