| DPOGS204971 | ||
|---|---|---|
| Transcript | DPOGS204971-TA | 222 bp |
| Protein | DPOGS204971-PA | 73 aa |
| Genomic position | DPSCF300123 - 273518-274080 | |
| RNAseq coverage | 356519x (Rank: top 0%) | |
| Annotation | ||||
|---|---|---|---|---|
| Heliconius | HMEL009465 | 8e-36 | 92.96% | |
| Bombyx | BGIBMGA010139-TA | 5e-37 | 98.59% | |
| Drosophila | RpS27-PA | 2e-32 | 86.11% | |
| EBI UniRef50 | UniRef50_B0WER7 | 5e-31 | 85.92% | Ribosomal protein S27 n=17 Tax=Eukaryota RepID=B0WER7_CULQU |
| NCBI RefSeq | NP_001037277.1 | 2e-35 | 98.59% | ribosomal protein S27 [Bombyx mori] |
| NCBI nr blastp | gi|112983932 | 6e-34 | 98.59% | ribosomal protein S27 [Bombyx mori] |
| NCBI nr blastx | gi|112983932 | 2e-35 | 100.00% | ribosomal protein S27 [Bombyx mori] |
| Group | ||||
|---|---|---|---|---|
| Gene Ontology | GO:0005840 | 2.8e-58 | ribosome | |
| GO:0006412 | 2.8e-58 | translation | ||
| GO:0005622 | 2.8e-58 | intracellular | ||
| GO:0003735 | 2.8e-58 | structural constituent of ribosome | ||
| KEGG pathway | aga:AgaP_AGAP007157 | 4e-31 | ||
| K02978 (RP-S27e, RPS27) | maps-> | Ribosome | ||
| InterPro domain | [1-70] IPR000592 | 2.8e-58 | Ribosomal protein S27e | |
| [28-70] IPR023407 | 3.7e-25 | Ribosomal protein S27e, zinc-binding domain | ||
| [28-70] IPR011332 | 3.3e-18 | Ribosomal protein, zinc-binding domain | ||
| Orthology group | MCL11961 | Multiple-copy universal gene | ||
| Genotypes for resequenced monarchs and outgroup Danaus species |
|---|
>DPOGS204971-TA
ATGCCGCTCGCAATTGATTTGCTGCACCCTTCGCCCGCGTCGGAGAGGAGGAAGCACAAGCTCAAAAGGCTAGTGCCCCATCCTAACTCCTATTTCATGGACGTGAAATGCCCTGGTTGCTACAAAATCACAACGGTATTCAGTCACGCGCAGAGAGTAGTGGTATGTGCTGGGTGTTCGACAATTCTCTGCCAACCCACTGGTGGCCGCGGATCTAATTGA
>DPOGS204971-PA
MPLAIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRGSN-