DPOGS205205 | ||
---|---|---|
Transcript | DPOGS205205-TA | 282 bp |
Protein | DPOGS205205-PA | 93 aa |
Genomic position | DPSCF300265 - 238654-242489 | |
RNAseq coverage | 0x (Rank: top 96%) |
Annotation | ||||
---|---|---|---|---|
Heliconius | HMEL014753 | 2e-22 | 100.00% |   |
Bombyx | BGIBMGA003901-TA | 1e-22 | 57.45% |   |
Drosophila | ATPsyn-beta-PA | 1e-20 | 91.30% |   |
EBI UniRef50 | UniRef50_P06576 | 2e-18 | 84.00% | ATP synthase subunit beta, mitochondrial n=9304 Tax=root RepID=ATPB_HUMAN |
NCBI RefSeq | XP_001626437.1 | 2e-19 | 93.48% | predicted protein [Nematostella vectensis] |
NCBI nr blastp | gi|380021893 | 9e-19 | 83.02% | PREDICTED: ATP synthase subunit beta, mitochondrial-like [Apis florea] |
NCBI nr blastx | gi|380021893 | 2e-17 | 83.02% | PREDICTED: ATP synthase subunit beta, mitochondrial-like [Apis florea] |
Group | ||||
---|---|---|---|---|
Gene Ontology | GO:0005524 | 1.3e-11 | ATP binding | |
GO:0033178 | 8e-07 | proton-transporting two-sector ATPase complex, catalytic domain | ||
GO:0015991 | 8e-07 | ATP hydrolysis coupled proton transport | ||
GO:0016820 | 8e-07 | hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances | ||
KEGG pathway | zro:ZYRO0D01760g | 5e-19 |   | |
  | K02133 (ATPeF1B, ATP5B) | maps-> | Huntington's disease | |
  |   |   | Oxidative phosphorylation | |
  |   |   | Alzheimer's disease | |
  |   |   | Parkinson's disease | |
InterPro domain | [1-47] IPR000194 | 1.3e-11 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | |
[53-91] IPR024034 | 1.1e-07 | ATPase, F1 complex beta subunit/V1 complex, C-terminal | ||
[59-91] IPR000793 | 8e-07 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | ||
Orthology group |   |
Genotypes for resequenced monarchs and outgroup Danaus species |
---|
>DPOGS205205-TA
ATGAACGAGCCCCCGGGAGCCAGAGCTCGTGTCGCCCTCACTGGGTTGACCCTCGCCGAGCACTTTAGGGACAAGGAAGGACAGGATGTGCTGCTGTTCGTTGATAACATCTTCAGATTCACTCAAGCCGGTTCCGAGTATGATCAAATTAATCGTATAGATCCCTTTCGCCCTAAGATTCTGATGGGTGAGTTGGACCACATCCCTGAAGCTGCTTTCTACATGGTGGGCACTATAGAGGACGTGATCGCCAAGTCACAGGCTCTAGCCAAATCAGTCTAG
>DPOGS205205-PA
MNEPPGARARVALTGLTLAEHFRDKEGQDVLLFVDNIFRFTQAGSEYDQINRIDPFRPKILMGELDHIPEAAFYMVGTIEDVIAKSQALAKSV-