| DPOGS215271 | ||
|---|---|---|
| Transcript | DPOGS215271-TA | 207 bp |
| Protein | DPOGS215271-PA | 68 aa |
| Genomic position | DPSCF300047 + 487541-487838 | |
| RNAseq coverage | 152x (Rank: top 53%) | |
| Annotation | ||||
|---|---|---|---|---|
| Heliconius | HMEL011989 | 2e-33 | 97.06% | |
| Bombyx | BGIBMGA010954-TA | 2e-26 | 91.80% | |
| Drosophila | ave-PA | 6e-17 | 62.90% | |
| EBI UniRef50 | UniRef50_E0VKS9 | 1e-16 | 56.72% | Ankyrin repeat-containing protein, putative n=6 Tax=Neoptera RepID=E0VKS9_PEDHC |
| NCBI RefSeq | XP_973641.1 | 2e-18 | 68.85% | PREDICTED: similar to GA15868-PA [Tribolium castaneum] |
| NCBI nr blastp | gi|332374270 | 2e-18 | 65.67% | unknown [Dendroctonus ponderosae] |
| NCBI nr blastx | gi|332374270 | 1e-18 | 65.67% | unknown [Dendroctonus ponderosae] |
| Group | ||||
|---|---|---|---|---|
| Gene Ontology | GO:0005515 | 1.7e-09 | protein binding | |
| KEGG pathway | ||||
| InterPro domain | [2-46] IPR010993 | 1.7e-09 | Sterile alpha motif homology | |
| [2-46] IPR011510 | 8.5e-09 | Sterile alpha motif, type 2 | ||
| [2-50] IPR013761 | 9.5e-09 | Sterile alpha motif-type | ||
| Orthology group | MCL14846 | Single-copy universal gene | ||
| Genotypes for resequenced monarchs and outgroup Danaus species |
|---|
>DPOGS215271-TA
ATGTACTGGGAGAGATTTCATGAGCACGACATCACAGGCAGGGCTTTAGTTCGGATAAATGATAACACATTACTAAGAATGGGAATCATAAATAAGGAGCATCGGGAGGCTATCTGGCGAGAAATATTAAAGTTGAGGCTTAAGACTGATATTGTAGAAATAAGGGATTTGGAACGGAGACATTACTATTTCAACTATGATTTGTGA
>DPOGS215271-PA
MYWERFHEHDITGRALVRINDNTLLRMGIINKEHREAIWREILKLRLKTDIVEIRDLERRHYYFNYDL-