Monarch geneset OGS2.0

DPOGS215871
TranscriptDPOGS215871-TA249 bp
ProteinDPOGS215871-PA82 aa
Genomic positionDPSCF300029 - 649320-652288
RNAseq coverage1247x (Rank: top 10%)
Annotation
HeliconiusHMEL0071254e-2572.46% 
BombyxBGIBMGA000419-TA2e-1959.42% 
DrosophilaCG9914-PA6e-1146.03% 
EBI UniRef50UniRef50_D3TM794e-1250.77%3-hydroxyacyl-CoA dehydrogenase n=2 Tax=Neoptera RepID=D3TM79_GLOMM
NCBI RefSeqXP_308454.42e-1256.67%AGAP007378-PB [Anopheles gambiae str. PEST]
NCBI nr blastpgi|3123848236e-1258.06%hypothetical protein AND_01493 [Anopheles darlingi]
NCBI nr blastxgi|3123848231e-1158.06%hypothetical protein AND_01493 [Anopheles darlingi]
Group
KEGG pathwaydgr:Dgri_GH122789e-12 
 K13247 (CRYL1)maps-> Pentose and glucuronate interconversions
Orthology group 
Genotypes for resequenced monarchs and outgroup Danaus species

Nucleotide sequence:

>DPOGS215871-TA
ATGGCGAGTAAATATAAAACTGAGAAAGTTGGAATTGTTGGGAGGTACGGTGAGACAATCAATAGCGTAAGTAAGACTTTTGGTGAGATCCCTCACATGCCCACATCAAAGAGTGCGGAAACGATATGCGCTCAACTAAACGATATGGTTCCTATCGAGAGGCTTCCCGAGAGACGAGCCTGGAGGGACGCTTGCCTCACACGTCTATCATTGCTCAAGAAAGAAATGAACGCAAAATATAAAAAGTAA

Protein sequence:

>DPOGS215871-PA
MASKYKTEKVGIVGRYGETINSVSKTFGEIPHMPTSKSAETICAQLNDMVPIERLPERRAWRDACLTRLSLLKKEMNAKYKK-