| New model in OGS2.0 | DPOGS204182 |
|---|---|
| Genomic Position | scaffold1124:+ 60565-61846 |
| See gene structure | |
| CDS Length | 567 |
| Paired RNAseq reads | 19 |
| Single RNAseq reads | 124 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA005108 (7e-52) |
| Best Drosophila hit | doublesex, isoform A (3e-19) |
| Best Human hit | doublesex- and mab-3-related transcription factor 3 (1e-10) |
| Best NR hit (blastp) | Bmdsx [Bombyx mori] (2e-65) |
| Best NR hit (blastx) | Bmdsx [Bombyx mori] (2e-46) |
| GeneOntology terms | GO:0007283 spermatogenesis GO:0019101 female somatic sex determination GO:0005634 nucleus GO:0007530 sex determination GO:0003704 specific RNA polymerase II transcription factor activity GO:0018993 somatic sex determination GO:0008270 zinc ion binding GO:0006366 transcription from RNA polymerase II promoter GO:0003677 DNA binding GO:0007548 sex differentiation GO:0003700 sequence-specific DNA binding transcription factor activity GO:0007619 courtship behavior GO:0045433 male courtship behavior, veined wing generated song production GO:0003702 RNA polymerase II transcription factor activity GO:0007486 imaginal disc-derived female genitalia development GO:0035215 genital disc development GO:0007485 imaginal disc-derived male genitalia development GO:0019102 male somatic sex determination GO:0008049 male courtship behavior GO:0045497 female analia development GO:0035263 genital disc sexually dimorphic development GO:0045496 male analia development GO:0045498 sex comb development GO:0046660 female sex differentiation GO:0048071 sex-specific pigmentation GO:0007417 central nervous system development GO:0003729 mRNA binding GO:0045893 positive regulation of transcription, DNA-dependent GO:0045892 negative regulation of transcription, DNA-dependent GO:0048086 negative regulation of developmental pigmentation GO:0045944 positive regulation of transcription from RNA polymerase II promoter GO:0045570 regulation of imaginal disc growth GO:0007483 genital disc morphogenesis GO:0000122 negative regulation of transcription from RNA polymerase II promoter GO:0007610 behavior GO:0006355 regulation of transcription, DNA-dependent GO:0046661 male sex differentiation GO:0030528 transcription regulator activity GO:0045449 regulation of transcription GO:0000398 nuclear mRNA splicing, via spliceosome GO:0042803 protein homodimerization activity GO:0005515 protein binding |
| InterPro families | IPR001275 DM DNA-binding |
| Orthology group | MCL17837 |
Nucleotide sequence:
ATGGTCTCCGTGGGCGCGTGGAGGCGTCGCACTCCCGACGACTGTGAAGACAGGTCGGAA
CCCGGCGCCTCCAGCTCTGGAGTCCCGCGGGCGCCGCCGAACTGCGCCCGCTGCCGCAAC
CACAGGCTGAAGATCGAGCTGAAAGGCCACAAGCGCTATTGCAAGTACCGCTACTGTACT
TGTGAGAAGTGCCGTCTCACCGCCGACAGGCAGAGGGTTATGGCTCTGCAAACGGCGTTG
CGGCGAGCCCAAGCGCAGGACGAAGCGCGGGCTCGGGCTCTGGAGACGGGAATTCAGCCG
CCAGGGATAGAATTGGACAGGCCGGAGCCTCCGACAGTGAAGGCTCCTAGGAGTCCCGTG
GTGCCGCCACCGGCTGCTATTGACCGTCGATCGCTGGGCTCAGCCAGCTGTGATTCAATT
CCCGAATCACCTCCGGGAATGTCGCCGTATTCAGCTCCTCCGGCGTCCGCGCCTCCACAG
CCGACCATGCCGCCGCTACTGCCGCCACAGCAACCAGGGAAAATCCCATTAAAATCGGAC
CAGCACTTAGAGATGAGCGGCGCGTAG
Protein sequence:
MVSVGAWRRRTPDDCEDRSEPGASSSGVPRAPPNCARCRNHRLKIELKGHKRYCKYRYCT
CEKCRLTADRQRVMALQTALRRAQAQDEARARALETGIQPPGIELDRPEPPTVKAPRSPV
VPPPAAIDRRSLGSASCDSIPESPPGMSPYSAPPASAPPQPTMPPLLPPQQPGKIPLKSD
QHLEMSGA