| New model in OGS2.0 | DPOGS205649 |
|---|---|
| Genomic Position | scaffold569:+ 42694-49425 |
| See gene structure | |
| CDS Length | 330 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 128 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA005094 (4e-09) |
| Best Drosophila hit | ABC transporter expressed in trachea, isoform B (8e-10) |
| Best Human hit | ATP-binding cassette sub-family G member 1 isoform 2 (3e-10) |
| Best NR hit (blastp) | PREDICTED: similar to ATP-binding cassette sub-family G member 1 isoform 2 [Canis familiaris] (4e-08) |
| Best NR hit (blastx) | PREDICTED: similar to ATP-binding cassette sub-family G member 1 isoform 2 [Canis familiaris] (7e-08) |
| GeneOntology terms | GO:0000166 nucleotide binding GO:0005524 ATP binding GO:0005548 phospholipid transporter activity GO:0005768 endosome GO:0005794 Golgi apparatus GO:0005886 plasma membrane GO:0006810 transport GO:0008203 cholesterol metabolic process GO:0009897 external side of plasma membrane GO:0010033 response to organic substance GO:0010872 regulation of cholesterol esterification GO:0010875 positive regulation of cholesterol efflux GO:0010888 negative regulation of lipid storage GO:0016020 membrane GO:0016021 integral to membrane GO:0016887 ATPase activity GO:0017127 cholesterol transporter activity GO:0019534 toxin transporter activity GO:0030301 cholesterol transport GO:0032367 intracellular cholesterol transport GO:0033344 cholesterol efflux GO:0033700 phospholipid efflux GO:0033993 response to lipid GO:0034041 sterol-transporting ATPase activity GO:0034374 low-density lipoprotein particle remodeling GO:0034375 high-density lipoprotein particle remodeling GO:0034436 glycoprotein transport GO:0034437 glycoprotein transporter activity GO:0042632 cholesterol homeostasis GO:0042803 protein homodimerization activity GO:0042987 amyloid precursor protein catabolic process GO:0043531 ADP binding GO:0043691 reverse cholesterol transport GO:0045449 regulation of transcription GO:0045542 positive regulation of cholesterol biosynthetic process GO:0046982 protein heterodimerization activity GO:0055037 recycling endosome GO:0055091 phospholipid homeostasis GO:0055099 response to high density lipoprotein stimulus |
| InterPro families | IPR004881 Ribosome biogenesis GTPase RsgA, putative IPR020064 ABC transporter, G1-like |
| Orthology group | ND |
Nucleotide sequence:
ATGGCTTCGGACAGCCAATCAGATTCACAAGAGACCAATTCTACAGCATTGGTAGAAGAT
TCTCTAAATATTACCTTTGAGGATGTGTGCTACAAAGTTAGAGATTTGTTCTCGGGTGGA
GAGATGGGCGGGGCCACTGAACGATGGGAGCTACACGTGCGTCGCCGTCTCACACCCCGA
AAGGCCAAAAATAGTTTGCGTATACTCGGACGCAAGACGATTCTCAAAGAAGTCAGCGGA
CAATTCAATTCAGGAGAGCTCAACGTAATTATAGGACAGTCTGGGGCGGGAAAGAGTTCT
CTCATGGATATACTAGCTGGATACACGTAA
Protein sequence:
MASDSQSDSQETNSTALVEDSLNITFEDVCYKVRDLFSGGEMGGATERWELHVRRRLTPR
KAKNSLRILGRKTILKEVSGQFNSGELNVIIGQSGAGKSSLMDILAGYT