| New model in OGS2.0 | DPOGS206006 |
|---|---|
| Genomic Position | scaffold1407:+ 24959-25249 |
| See gene structure | |
| CDS Length | 291 |
| Paired RNAseq reads | 117 |
| Single RNAseq reads | 1411 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA012665 (7e-38) |
| Best Drosophila hit | capping protein alpha (7e-32) |
| Best Human hit | F-actin-capping protein subunit alpha-1 (1e-29) |
| Best NR hit (blastp) | f-actin capping protein alpha [Aedes aegypti] (6e-36) |
| Best NR hit (blastx) | PREDICTED: similar to CG10540-PA [Nasonia vitripennis] (7e-30) |
| GeneOntology terms | GO:0051016 barbed-end actin filament capping GO:0008290 F-actin capping protein complex GO:0030036 actin cytoskeleton organization GO:0005869 dynactin complex GO:0007018 microtubule-based movement GO:0007015 actin filament organization GO:0003779 actin binding GO:0006911 phagocytosis, engulfment GO:0010591 regulation of lamellipodium assembly GO:0016324 apical plasma membrane GO:0030837 negative regulation of actin filament polymerization GO:0035220 wing disc development GO:0005875 microtubule associated complex GO:0007294 germarium-derived oocyte fate determination |
| InterPro families | IPR017865 F-actin capping protein, alpha subunit, conserved site IPR002189 WASH complex, F-actin capping protein, alpha subunit |
| Orthology group | MCL12008 |
Nucleotide sequence:
ATGCTCCGCGTTCAGGTGCACTACTACGAAGACGGCAACGTCCAGCTCGTTAGTTCCAAA
GAGGTCCGCGCGAGTCTAGCGGCTACCGGCGAAGCGGCTACCGCCAAGGAATTCGTGAGG
TCGGTTTGTGACGCGGAGAACGCGTACCAGACGGCGATATCTGACAATTACAAGACAATG
AGTGACACCACGTTCAAAGCGCTCCGACGACAGCTCCCGGTGACCCGCAGTAAGATTGAC
TGGACGCGGCTGGTGTCCTACACTATCGGTAAGGAGTTGAAGAGCCAATGA
Protein sequence:
MLRVQVHYYEDGNVQLVSSKEVRASLAATGEAATAKEFVRSVCDAENAYQTAISDNYKTM
SDTTFKALRRQLPVTRSKIDWTRLVSYTIGKELKSQ