| Genomic Position | scaffold1563:- 10189-13548 |
|---|---|
| See gene structure | |
| CDS Length | 195 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 1 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | ND |
| Best Drosophila hit | ND |
| Best Human hit | msx2-interacting protein (2e-09) |
| Best NR hit (blastp) | PREDICTED: similar to split ends CG18497-PA [Tribolium castaneum] (2e-09) |
| Best NR hit (blastx) | PREDICTED: similar to split ends CG18497-PA [Tribolium castaneum] (3e-09) |
| GeneOntology terms | GO:0005515 protein binding GO:0003700 sequence-specific DNA binding transcription factor activity GO:0003677 DNA binding GO:0003714 transcription corepressor activity GO:0016563 transcription activator activity GO:0016564 transcription repressor activity GO:0003697 single-stranded DNA binding GO:0007219 Notch signaling pathway GO:0003723 RNA binding GO:0045449 regulation of transcription GO:0006357 regulation of transcription from RNA polymerase II promoter GO:0045892 negative regulation of transcription, DNA-dependent GO:0006350 transcription GO:0045941 positive regulation of transcription GO:0005488 binding GO:0003676 nucleic acid binding GO:0000166 nucleotide binding GO:0005634 nucleus |
| InterPro families | IPR012677 Nucleotide-binding, alpha-beta plait |
| Orthology group | ND |
Nucleotide sequence:
ATGGTTAGAGAGACTCGGCACCTGTGGGTTGGAAATTTACCCGATAACATACGTGAAGAC
CGAATAAGAGAGCATTTTAAACGTGAGCCCCTTGTAAGATCTAGATGTAGCTTTGTGAAG
AACGGAGGGCTCTGGGTGCTTCACAATAAAAGTCAAAAGCGAGGGGTTCAGATATCAAAT
CTGTATTCGACCTAA
Protein sequence:
MVRETRHLWVGNLPDNIREDRIREHFKREPLVRSRCSFVKNGGLWVLHNKSQKRGVQISN
LYST