New model in OGS2.0 | DPOGS213168 |
---|---|
Genomic Position | scaffold33103:- 3537-4170 |
See gene structure | |
CDS Length | 495 |
Paired RNAseq reads | 61 |
Single RNAseq reads | 638 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA007355 (2e-09) |
Best Drosophila hit | thickveins, isoform C (1e-07) |
Best Human hit | bone morphogenetic protein receptor type-1A precursor (2e-07) |
Best NR hit (blastp) | GJ15112 [Drosophila virilis] (3e-26) |
Best NR hit (blastx) | SAX, putative [Pediculus humanus corporis] (4e-20) |
GeneOntology terms | GO:0007391 dorsal closure GO:0007424 open tracheal system development GO:0005886 plasma membrane GO:0008101 decapentaplegic receptor signaling pathway GO:0009953 dorsal/ventral pattern formation GO:0005025 transforming growth factor beta receptor activity, type I GO:0007476 imaginal disc-derived wing morphogenesis GO:0007179 transforming growth factor beta receptor signaling pathway GO:0050431 transforming growth factor beta binding GO:0030509 BMP signaling pathway GO:0007304 chorion-containing eggshell formation GO:0007448 anterior/posterior pattern formation, imaginal disc GO:0030718 germ-line stem cell maintenance GO:0042078 germ-line stem cell division GO:0046845 branched duct epithelial cell fate determination, open tracheal system GO:0030707 ovarian follicle cell development GO:0001763 morphogenesis of a branching structure GO:0006468 protein amino acid phosphorylation GO:0004672 protein kinase activity GO:0007507 heart development GO:0007181 transforming growth factor beta receptor complex assembly GO:0045705 negative regulation of salivary gland boundary specification GO:0001745 compound eye morphogenesis GO:0005524 ATP binding GO:0045887 positive regulation of synaptic growth at neuromuscular junction GO:0007274 neuromuscular synaptic transmission GO:0048100 wing disc anterior/posterior pattern formation GO:0035215 genital disc development GO:0016566 specific transcriptional repressor activity GO:0045570 regulation of imaginal disc growth GO:0005771 multivesicular body GO:0022407 regulation of cell-cell adhesion GO:0048636 positive regulation of muscle organ development GO:0090254 cell elongation involved in imaginal disc-derived wing morphogenesis GO:0045595 regulation of cell differentiation |
InterPro families | IPR003605 TGF beta receptor, GS motif |
Orthology group | ND |
Nucleotide sequence:
ATGCAGTGTAAAAGTTCCCAAGTGCCACACCAACACCCCAAAGTGATAGAATGTTGTGAG
AAGGACCTCTGTAACCGTCGCCTCCGCCCTGTGTTGCCCGGTGGGTCGGAGGGCTCTCCG
CCCGCCCTTCCCGCGCCGCCATCCAGCCCCGCCCCGCCGGCGCTCGTGGCCGCCGCCCTG
TGCGTGGCTCTCCTAGCCGCCTTGGCAGCCTTGTGGGTGCTGCTGCGGAGGAGGCGCTCC
GGCAAGAGGCCGCCCTCGCCGCCCGTCATCGCCGATCATCCCGAGATCTCGTCCGGCTCG
GGCTCCGGCCTGCCGCTCCTCGTGCAGCGGACGGTCGCCAAGCAGATACAGATGGTGGAG
TCCATAGGGAAGGGACGCTACGGAGAGGTGTGGCTCGCGCGCTGGCGGGGGAGAAGGTCG
CCGTCAAGGTTTTCTTCACCACCGAGGAGGCTAGCTGGTTCCGGGAGACGGAGATCTACC
AGACGGTGCTCATGA
Protein sequence:
MQCKSSQVPHQHPKVIECCEKDLCNRRLRPVLPGGSEGSPPALPAPPSSPAPPALVAAAL
CVALLAALAALWVLLRRRRSGKRPPSPPVIADHPEISSGSGSGLPLLVQRTVAKQIQMVE
SIGKGRYGEVWLARWRGRRSPSRFSSPPRRLAGSGRRRSTRRCS