| New model in OGS2.0 | DPOGS206951 |
|---|---|
| Genomic Position | scaffold18:- 72437-73223 |
| See gene structure | |
| CDS Length | 360 |
| Paired RNAseq reads | 74 |
| Single RNAseq reads | 1006 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA002087 (2e-17) |
| Best Drosophila hit | ND |
| Best Human hit | macrophage migration inhibitory factor (2e-21) |
| Best NR hit (blastp) | macrophage migration inhibitory factor [Bombyx mori] (5e-48) |
| Best NR hit (blastx) | macrophage migration inhibitory factor [Bombyx mori] (2e-46) |
| GeneOntology terms | GO:0007166 cell surface receptor linked signaling pathway GO:0019752 carboxylic acid metabolic process GO:0042056 chemoattractant activity GO:0061081 positive regulation of myeloid leukocyte cytokine production involved in immune response GO:0005737 cytoplasm GO:0001516 prostaglandin biosynthetic process GO:0033138 positive regulation of peptidyl-serine phosphorylation GO:0043406 positive regulation of MAP kinase activity GO:0050715 positive regulation of cytokine secretion GO:0070207 protein homotrimerization GO:0016853 isomerase activity GO:0004167 dopachrome isomerase activity GO:0010739 positive regulation of protein kinase A signaling cascade GO:0031666 positive regulation of lipopolysaccharide-mediated signaling pathway GO:0045087 innate immune response GO:0033033 negative regulation of myeloid cell apoptosis GO:0048146 positive regulation of fibroblast proliferation GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation GO:0070374 positive regulation of ERK1 and ERK2 cascade GO:0005125 cytokine activity GO:0009986 cell surface GO:0032269 negative regulation of cellular protein metabolic process GO:0050178 phenylpyruvate tautomerase activity GO:0007569 cell aging GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator GO:0071157 negative regulation of cell cycle arrest GO:0005126 cytokine receptor binding GO:0010629 negative regulation of gene expression GO:0061078 positive regulation of prostaglandin secretion involved in immune response GO:0005576 extracellular region GO:0006954 inflammatory response GO:0005615 extracellular space GO:0030890 positive regulation of B cell proliferation GO:0042127 regulation of cell proliferation GO:0043498 cell surface binding GO:0090238 positive regulation of arachidonic acid secretion |
| InterPro families | IPR014347 Tautomerase IPR001398 Macrophage migration inhibitory factor |
| Orthology group | MCL10184 |
Nucleotide sequence:
ATGCCGCATTTAAGAATCGAAACGAATGTATCCAAAAGTAAAATACCTGAAGACTTCGTT
TCTAAAGCAATTCCAATTTTAGCAAATAGTCTTGGGAAACCTGCTCAATTTTGTGTGGTC
TCAATTATTCCCGATGTTCAAATGTGTTTTGGTGGTTCCAATGCTCCATGTGCCACAGCA
AGTTTAATGTCAATCGGGGCTCTTGGTCTGAATGAAAACAAAAAACATTCAAAAGTTTTG
TTTGAATTGGTTGAAAAAGAGCTGGGTATTCCTAAAGACAGAATGTATATAACATACCAA
AATGAACCATCCTCCAATGTCGGTTTCAAGGGAACAACATTCCATGATATTATTGGATGA
Protein sequence:
MPHLRIETNVSKSKIPEDFVSKAIPILANSLGKPAQFCVVSIIPDVQMCFGGSNAPCATA
SLMSIGALGLNENKKHSKVLFELVEKELGIPKDRMYITYQNEPSSNVGFKGTTFHDIIG