| New model in OGS2.0 | DPOGS212192 |
|---|---|
| Genomic Position | scaffold4186:+ 1507-6715 |
| See gene structure | |
| CDS Length | 477 |
| Paired RNAseq reads | 2 |
| Single RNAseq reads | 82 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA001198 (8e-23) |
| Best Drosophila hit | cyclin D, isoform E (1e-07) |
| Best Human hit | G1/S-specific cyclin-D2 (6e-09) |
| Best NR hit (blastp) | PREDICTED: similar to cyclin d [Acyrthosiphon pisum] (9e-24) |
| Best NR hit (blastx) | cyclin d [Culex quinquefasciatus] (6e-12) |
| GeneOntology terms | GO:0051726 regulation of cell cycle GO:0000307 cyclin-dependent protein kinase holoenzyme complex GO:0004672 protein kinase activity GO:0007595 lactation GO:0030968 endoplasmic reticulum unfolded protein response GO:0042493 response to drug GO:0000082 G1/S transition of mitotic cell cycle GO:0005622 intracellular GO:0045444 fat cell differentiation GO:0030178 negative regulation of Wnt receptor signaling pathway GO:0070141 response to UV-A GO:0000320 re-entry into mitotic cell cycle GO:0005515 protein binding GO:0030857 negative regulation of epithelial cell differentiation GO:0060749 mammary gland alveolus development GO:0045737 positive regulation of cyclin-dependent protein kinase activity GO:0033598 mammary gland epithelial cell proliferation GO:0060070 canonical Wnt receptor signaling pathway GO:0001934 positive regulation of protein amino acid phosphorylation GO:0016538 cyclin-dependent protein kinase regulator activity GO:0031571 mitotic cell cycle G1/S DNA damage checkpoint GO:0006974 response to DNA damage stimulus GO:0005634 nucleus GO:0051301 cell division GO:0019901 protein kinase binding |
| InterPro families | IPR011028 Cyclin-like IPR013763 Cyclin-related IPR006671 Cyclin, N-terminal IPR006670 Cyclin IPR015451 Cyclin D |
| Orthology group | ND |
Nucleotide sequence:
ATGAGGAAGGTTGTCACGACTTGGATGTTGGAGGTTTGTGAGGAACAGCAATGTGAAGAG
CAGGTGTTCCCTCTGGCTGTGAGCTACATGGACAGGTTTCTCGCCCAGCGTGCAATTTCA
CGGCAACAACTACAATTGCTGGCTGTCACCTCGCTGCTACTCGCCTCCAAGTTTCGCCAG
TGTCATCCTTTGTCGGTTGATCTACTCTGCGCTTATACTGATAACTCAGTTTTCCCTCAG
GAAGTCAGGATAGCTATAGATAGGGGTTGGTGTAGGATAGTGTGCGTGTTCAAGATTGAG
GTGGCCGGGTGCGTGTGGGGTAGGCGCGCCCGCGTGCGGCCGTTGCACGTTCTGGGTCGC
ACGGCCGGCATGCTAGCGACTCAGCGTTCGCAGTCTTGCAACGAGGAGGGAGCGTTCTTC
GGTGCAAGGGCGCTCCGTCGGCCGCGTGGGAAAGGTAGCGGCAGTCCGCCTTGCTAG
Protein sequence:
MRKVVTTWMLEVCEEQQCEEQVFPLAVSYMDRFLAQRAISRQQLQLLAVTSLLLASKFRQ
CHPLSVDLLCAYTDNSVFPQEVRIAIDRGWCRIVCVFKIEVAGCVWGRRARVRPLHVLGR
TAGMLATQRSQSCNEEGAFFGARALRRPRGKGSGSPPC