DPGLEAN14428 in OGS1.0

New model in OGS2.0DPOGS201796 
Genomic Positionscaffold12:- 88265-93665
See gene structure
CDS Length1011
Paired RNAseq reads  418
Single RNAseq reads  1007
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA013185 (3e-39)
Best Drosophila hit  p53, isoform C (2e-10)
Best Human hitcellular tumor antigen p53 isoform c (5e-15)
Best NR hit (blastp)  p53 tumor suppressor homologue [Bombyx mori] (5e-50)
Best NR hit (blastx)  p53 tumor suppressor homologue [Bombyx mori] (1e-53)
GeneOntology terms





























































































  		GO:0051262 protein tetramerization
GO:0003677 DNA binding
GO:0006289 nucleotide-excision repair
GO:0046982 protein heterodimerization activity
GO:0007569 cell aging
GO:0035035 histone acetyltransferase binding
GO:0019899 enzyme binding
GO:0030308 negative regulation of cell growth
GO:0019901 protein kinase binding
GO:0016563 transcription activator activity
GO:0005737 cytoplasm
GO:0005634 nucleus
GO:0005515 protein binding
GO:0000122 negative regulation of transcription from RNA polymerase II promoter
GO:0031065 positive regulation of histone deacetylation
GO:0008134 transcription factor binding
GO:0007050 cell cycle arrest
GO:0003682 chromatin binding
GO:0042981 regulation of apoptosis
GO:0008629 induction of apoptosis by intracellular signals
GO:0002360 T cell lineage commitment
GO:0006302 double-strand break repair
GO:0009792 embryo development ending in birth or egg hatching
GO:0043525 positive regulation of neuron apoptosis
GO:0010552 positive regulation of gene-specific transcription from RNA polymerase II promoter
GO:0005669 transcription factor TFIID complex
GO:0010843 promoter binding
GO:0008283 cell proliferation
GO:0002309 T cell proliferation involved in immune response
GO:0009303 rRNA transcription
GO:0033077 T cell differentiation in the thymus
GO:0035264 multicellular organism growth
GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0030154 cell differentiation
GO:0003700 sequence-specific DNA binding transcription factor activity
GO:0005626 insoluble fraction
GO:0042771 DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis
GO:0045944 positive regulation of transcription from RNA polymerase II promoter
GO:0005654 nucleoplasm
GO:0000060 protein import into nucleus, translocation
GO:0001836 release of cytochrome c from mitochondria
GO:0007369 gastrulation
GO:0008156 negative regulation of DNA replication
GO:0009651 response to salt stress
GO:0034644 cellular response to UV
GO:0051726 regulation of cell cycle
GO:0016604 nuclear body
GO:0043234 protein complex
GO:0005783 endoplasmic reticulum
GO:0006915 apoptosis
GO:0006284 base-excision repair
GO:0031625 ubiquitin protein ligase binding
GO:0005507 copper ion binding
GO:0000739 DNA strand annealing activity
GO:0005524 ATP binding
GO:0008104 protein localization
GO:0047485 protein N-terminus binding
GO:0007275 multicellular organismal development
GO:0008635 activation of caspase activity by cytochrome c
GO:0051097 negative regulation of helicase activity
GO:0002347 response to tumor cell
GO:0006974 response to DNA damage stimulus
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
GO:0051276 chromosome organization
GO:0007265 Ras protein signal transduction
GO:0006355 regulation of transcription, DNA-dependent
GO:0008270 zinc ion binding
GO:0046902 regulation of mitochondrial membrane permeability
GO:0001756 somitogenesis
GO:0035033 histone deacetylase regulator activity
GO:0016605 PML body
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0010332 response to gamma radiation
GO:0005739 mitochondrion
GO:0005730 nucleolus
GO:0006461 protein complex assembly
GO:0051721 protein phosphatase 2A binding
GO:0044419 interspecies interaction between organisms
GO:0046872 metal ion binding
GO:0002326 B cell lineage commitment
GO:0005829 cytosol
GO:0007417 central nervous system development
GO:0010165 response to X-ray
GO:0042493 response to drug
GO:0043066 negative regulation of apoptosis
GO:0016363 nuclear matrix
GO:0002020 protease binding
GO:0051087 chaperone binding
GO:0006983 ER overload response
GO:0042149 cellular response to glucose starvation
GO:0001701 in utero embryonic development
GO:0005657 replication fork
GO:0007406 negative regulation of neuroblast proliferation
GO:0048147 negative regulation of fibroblast proliferation
GO:0031571 mitotic cell cycle G1/S DNA damage checkpoint
InterPro families



  		IPR002117 p53 tumour suppressor family
IPR011615 p53, DNA-binding domain
IPR015551 p53 tumour suppressor, deltaN isoforms
IPR008967 p53-like transcription factor, DNA-binding
IPR012346 p53/RUNT-type transcription factor, DNA-binding domain
Orthology groupMCL10568

Nucleotide sequence:

ATGGAGTGCGTGGACAAATCTGAGAATATCGATGGGAATGTGGACACAAATGATTTGCCT
AACGACGATCAAGTTCTATCTTTGATAAGTGACGCAATGTTCGTCGATTCAATATTAAGT
GTCAATCCGCTTGGTCCACCAACGAGAGGAAATTTTGCCGGTGAGGCAAACTTTGAGATA
TCAATAGACGGGTCACAAACCAGGAGAAAAAAGTTCCTATTCTCGGCGAAACTGAATAAG
ATATATGTGGATATTGGTGTTGACTTTCCTTTGAAATTCAACTGGGACGCGTCCAAGTAC
CAGTACATGTATGTCAGAGCCACTGTCATATACTCAGACGCTGATCAGGCCCAGAAGAAG
GTTGAGGCCTGCTACCAACATTCCTTTTACTCGAACACAGCAAACTCTGTGACCGGCCGC
AACGTCCTCCGTTCCGGTCGCGAGCTGGGTGTACCGGATGTGTATTATTTCGGACGTGAT
GACGACCCGGACTCGTGGTATTCGGTCCTCGTGGCTGGGAATCCGTCCCTGGAACATCCC
TACCAATTCGTCTGCAAGAACAGCTGCACGTCGGGCATCAATAGACGGAATATCGAAATA
ATATTCACGCTGGAAGATGCCTTAGGAGTGGTGTTCGGCCGGCAGAGTGTTGGTGTACGG
GTGTGTTCGTGTCCCAGGAGGGATATGAACAAGGATGAGGTTGCTATGGAGGGAACTGGT
GTAAAGAGACCAGCCCCCTCACAACCAAACACAACCAAGAAGATAAAGATAGACGTGCAA
CACCAGCAGCAACAGCAACAACACGACACTGTTGTCACATTGCCATCGTTATCCGTGGTT
GGAATACCAACTGTGGTATCCGGTCTCCGTGTAATGCTGAGTATGCAGGAACAGGCTCTA
GCCATAAAGACTGATAACTACCAGCCTGTGGATGATCTCATCAAATGTATAACTGATATG
AAGAAATGCATAGATGACCTTGAGGATAAGCTGAAGGACAAACCATCTTAA

Protein sequence:

MECVDKSENIDGNVDTNDLPNDDQVLSLISDAMFVDSILSVNPLGPPTRGNFAGEANFEI
SIDGSQTRRKKFLFSAKLNKIYVDIGVDFPLKFNWDASKYQYMYVRATVIYSDADQAQKK
VEACYQHSFYSNTANSVTGRNVLRSGRELGVPDVYYFGRDDDPDSWYSVLVAGNPSLEHP
YQFVCKNSCTSGINRRNIEIIFTLEDALGVVFGRQSVGVRVCSCPRRDMNKDEVAMEGTG
VKRPAPSQPNTTKKIKIDVQHQQQQQQHDTVVTLPSLSVVGIPTVVSGLRVMLSMQEQAL
AIKTDNYQPVDDLIKCITDMKKCIDDLEDKLKDKPS