New model in OGS2.0 | DPOGS201796 |
---|---|
Genomic Position | scaffold12:- 88265-93665 |
See gene structure | |
CDS Length | 1011 |
Paired RNAseq reads | 418 |
Single RNAseq reads | 1007 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA013185 (3e-39) |
Best Drosophila hit | p53, isoform C (2e-10) |
Best Human hit | cellular tumor antigen p53 isoform c (5e-15) |
Best NR hit (blastp) | p53 tumor suppressor homologue [Bombyx mori] (5e-50) |
Best NR hit (blastx) | p53 tumor suppressor homologue [Bombyx mori] (1e-53) |
GeneOntology terms | GO:0051262 protein tetramerization GO:0003677 DNA binding GO:0006289 nucleotide-excision repair GO:0046982 protein heterodimerization activity GO:0007569 cell aging GO:0035035 histone acetyltransferase binding GO:0019899 enzyme binding GO:0030308 negative regulation of cell growth GO:0019901 protein kinase binding GO:0016563 transcription activator activity GO:0005737 cytoplasm GO:0005634 nucleus GO:0005515 protein binding GO:0000122 negative regulation of transcription from RNA polymerase II promoter GO:0031065 positive regulation of histone deacetylation GO:0008134 transcription factor binding GO:0007050 cell cycle arrest GO:0003682 chromatin binding GO:0042981 regulation of apoptosis GO:0008629 induction of apoptosis by intracellular signals GO:0002360 T cell lineage commitment GO:0006302 double-strand break repair GO:0009792 embryo development ending in birth or egg hatching GO:0043525 positive regulation of neuron apoptosis GO:0010552 positive regulation of gene-specific transcription from RNA polymerase II promoter GO:0005669 transcription factor TFIID complex GO:0010843 promoter binding GO:0008283 cell proliferation GO:0002309 T cell proliferation involved in immune response GO:0009303 rRNA transcription GO:0033077 T cell differentiation in the thymus GO:0035264 multicellular organism growth GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator GO:0030154 cell differentiation GO:0003700 sequence-specific DNA binding transcription factor activity GO:0005626 insoluble fraction GO:0042771 DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis GO:0045944 positive regulation of transcription from RNA polymerase II promoter GO:0005654 nucleoplasm GO:0000060 protein import into nucleus, translocation GO:0001836 release of cytochrome c from mitochondria GO:0007369 gastrulation GO:0008156 negative regulation of DNA replication GO:0009651 response to salt stress GO:0034644 cellular response to UV GO:0051726 regulation of cell cycle GO:0016604 nuclear body GO:0043234 protein complex GO:0005783 endoplasmic reticulum GO:0006915 apoptosis GO:0006284 base-excision repair GO:0031625 ubiquitin protein ligase binding GO:0005507 copper ion binding GO:0000739 DNA strand annealing activity GO:0005524 ATP binding GO:0008104 protein localization GO:0047485 protein N-terminus binding GO:0007275 multicellular organismal development GO:0008635 activation of caspase activity by cytochrome c GO:0051097 negative regulation of helicase activity GO:0002347 response to tumor cell GO:0006974 response to DNA damage stimulus GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway GO:0051276 chromosome organization GO:0007265 Ras protein signal transduction GO:0006355 regulation of transcription, DNA-dependent GO:0008270 zinc ion binding GO:0046902 regulation of mitochondrial membrane permeability GO:0001756 somitogenesis GO:0035033 histone deacetylase regulator activity GO:0016605 PML body GO:0030330 DNA damage response, signal transduction by p53 class mediator GO:0010332 response to gamma radiation GO:0005739 mitochondrion GO:0005730 nucleolus GO:0006461 protein complex assembly GO:0051721 protein phosphatase 2A binding GO:0044419 interspecies interaction between organisms GO:0046872 metal ion binding GO:0002326 B cell lineage commitment GO:0005829 cytosol GO:0007417 central nervous system development GO:0010165 response to X-ray GO:0042493 response to drug GO:0043066 negative regulation of apoptosis GO:0016363 nuclear matrix GO:0002020 protease binding GO:0051087 chaperone binding GO:0006983 ER overload response GO:0042149 cellular response to glucose starvation GO:0001701 in utero embryonic development GO:0005657 replication fork GO:0007406 negative regulation of neuroblast proliferation GO:0048147 negative regulation of fibroblast proliferation GO:0031571 mitotic cell cycle G1/S DNA damage checkpoint |
InterPro families | IPR002117 p53 tumour suppressor family IPR011615 p53, DNA-binding domain IPR015551 p53 tumour suppressor, deltaN isoforms IPR008967 p53-like transcription factor, DNA-binding IPR012346 p53/RUNT-type transcription factor, DNA-binding domain |
Orthology group | MCL10568 |
Nucleotide sequence:
ATGGAGTGCGTGGACAAATCTGAGAATATCGATGGGAATGTGGACACAAATGATTTGCCT
AACGACGATCAAGTTCTATCTTTGATAAGTGACGCAATGTTCGTCGATTCAATATTAAGT
GTCAATCCGCTTGGTCCACCAACGAGAGGAAATTTTGCCGGTGAGGCAAACTTTGAGATA
TCAATAGACGGGTCACAAACCAGGAGAAAAAAGTTCCTATTCTCGGCGAAACTGAATAAG
ATATATGTGGATATTGGTGTTGACTTTCCTTTGAAATTCAACTGGGACGCGTCCAAGTAC
CAGTACATGTATGTCAGAGCCACTGTCATATACTCAGACGCTGATCAGGCCCAGAAGAAG
GTTGAGGCCTGCTACCAACATTCCTTTTACTCGAACACAGCAAACTCTGTGACCGGCCGC
AACGTCCTCCGTTCCGGTCGCGAGCTGGGTGTACCGGATGTGTATTATTTCGGACGTGAT
GACGACCCGGACTCGTGGTATTCGGTCCTCGTGGCTGGGAATCCGTCCCTGGAACATCCC
TACCAATTCGTCTGCAAGAACAGCTGCACGTCGGGCATCAATAGACGGAATATCGAAATA
ATATTCACGCTGGAAGATGCCTTAGGAGTGGTGTTCGGCCGGCAGAGTGTTGGTGTACGG
GTGTGTTCGTGTCCCAGGAGGGATATGAACAAGGATGAGGTTGCTATGGAGGGAACTGGT
GTAAAGAGACCAGCCCCCTCACAACCAAACACAACCAAGAAGATAAAGATAGACGTGCAA
CACCAGCAGCAACAGCAACAACACGACACTGTTGTCACATTGCCATCGTTATCCGTGGTT
GGAATACCAACTGTGGTATCCGGTCTCCGTGTAATGCTGAGTATGCAGGAACAGGCTCTA
GCCATAAAGACTGATAACTACCAGCCTGTGGATGATCTCATCAAATGTATAACTGATATG
AAGAAATGCATAGATGACCTTGAGGATAAGCTGAAGGACAAACCATCTTAA
Protein sequence:
MECVDKSENIDGNVDTNDLPNDDQVLSLISDAMFVDSILSVNPLGPPTRGNFAGEANFEI
SIDGSQTRRKKFLFSAKLNKIYVDIGVDFPLKFNWDASKYQYMYVRATVIYSDADQAQKK
VEACYQHSFYSNTANSVTGRNVLRSGRELGVPDVYYFGRDDDPDSWYSVLVAGNPSLEHP
YQFVCKNSCTSGINRRNIEIIFTLEDALGVVFGRQSVGVRVCSCPRRDMNKDEVAMEGTG
VKRPAPSQPNTTKKIKIDVQHQQQQQQHDTVVTLPSLSVVGIPTVVSGLRVMLSMQEQAL
AIKTDNYQPVDDLIKCITDMKKCIDDLEDKLKDKPS