| New model in OGS2.0 | DPOGS214706 |
|---|---|
| Genomic Position | scaffold3958:- 9705-9977 |
| See gene structure | |
| CDS Length | 273 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 0 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA007070 (9e-18) |
| Best Drosophila hit | inwardly rectifying potassium channel 2, isoform B (1e-14) |
| Best Human hit | ATP-sensitive inward rectifier potassium channel 11 isoform 1 (4e-12) |
| Best NR hit (blastp) | inwardly rectifying k+ channel, putative [Aedes aegypti] (2e-14) |
| Best NR hit (blastx) | inwardly rectifying k+ channel, putative [Aedes aegypti] (4e-14) |
| GeneOntology terms | GO:0015467 G-protein activated inward rectifier potassium channel activity GO:0005242 inward rectifier potassium channel activity GO:0006813 potassium ion transport GO:0042391 regulation of membrane potential GO:0016021 integral to membrane |
| InterPro families | IPR013521 Potassium channel, inwardly rectifying, Kir, conserved region 2 IPR014756 Immunoglobulin E-set IPR001838 Potassium channel, inwardly rectifying, Kir-like IPR013518 Potassium channel, inwardly rectifying, Kir, cytoplasmic |
| Orthology group | ND |
Nucleotide sequence:
ATGGAAATAGTGGTCGTATTTGAAGGTATTATTGAATCAACTGGTCAGCCAGTACAAGCA
AGATCAAGTTTCACCGAATATGATATACTTTGGGGTCAACGTTTTGTTTCAATGGTTGGA
TTCAATTTCGACAAATTAATGTATCATGTGGATTTTTCAAAATTATCCGATGTACAACGA
GTTGATACTCCTCTCTGTTCTCCCAATGAGTATGATTACCTTTTAAATAAGTTCTCTGAT
TCTGTGACATTGTCATCTAAATATGAATTTTAA
Protein sequence:
MEIVVVFEGIIESTGQPVQARSSFTEYDILWGQRFVSMVGFNFDKLMYHVDFSKLSDVQR
VDTPLCSPNEYDYLLNKFSDSVTLSSKYEF