New model in OGS2.0 | DPOGS210325  |
---|---|
Genomic Position | scaffold160:- 326847-327859 |
See gene structure | |
CDS Length | 114 |
Paired RNAseq reads   | 0 |
Single RNAseq reads   | 37 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | ND |
Best Drosophila hit   | CG7220, isoform C (2e-15) |
Best Human hit | probable ubiquitin-conjugating enzyme E2 W isoform 2 (2e-15) |
Best NR hit (blastp)   | PREDICTED: similar to AGAP005324-PB [Tribolium castaneum] (9e-14) |
Best NR hit (blastx)   | PREDICTED: similar to CG7220 CG7220-PA [Acyrthosiphon pisum] (9e-16) |
GeneOntology terms    | GO:0019787 small conjugating protein ligase activity GO:0043687 post-translational protein modification GO:0051246 regulation of protein metabolic process |
InterPro families   | ND |
Orthology group | ND |
Nucleotide sequence:
ATGCTCAGTAGCTGTAAGGAGAAGAAACGGCCGCCGGATAATTCGTTTTACGTTAAGACA
TGCAACAAAAACCCCAAAAAAACGAAATGGTGGTACCATGATGATTCAGTTTAA
Protein sequence:
MLSSCKEKKRPPDNSFYVKTCNKNPKKTKWWYHDDSV