| New model in OGS2.0 | DPOGS204257 |
|---|---|
| Genomic Position | scaffold388:+ 43768-44166 |
| See gene structure | |
| CDS Length | 399 |
| Paired RNAseq reads | 153 |
| Single RNAseq reads | 678 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA007531 (5e-60) |
| Best Drosophila hit | tramtrack, isoform A (7e-38) |
| Best Human hit | ND |
| Best NR hit (blastp) | tramtrack [Tribolium castaneum] (4e-45) |
| Best NR hit (blastx) | hypothetical protein TcasGA2_TC013843 [Tribolium castaneum] (9e-45) |
| GeneOntology terms | GO:0007422 peripheral nervous system development GO:0005634 nucleus GO:0006357 regulation of transcription from RNA polymerase II promoter GO:0003704 specific RNA polymerase II transcription factor activity GO:0000122 negative regulation of transcription from RNA polymerase II promoter GO:0016564 transcription repressor activity GO:0045467 R7 cell development GO:0005700 polytene chromosome GO:0042803 protein homodimerization activity GO:0005515 protein binding GO:0046843 dorsal appendage formation GO:0003677 DNA binding GO:0008270 zinc ion binding GO:0001709 cell fate determination GO:0016566 specific transcriptional repressor activity GO:0003682 chromatin binding GO:0045892 negative regulation of transcription, DNA-dependent GO:0030707 ovarian follicle cell development GO:0048813 dendrite morphogenesis GO:0048666 neuron development GO:0001964 startle response GO:0031987 locomotion involved in locomotory behavior GO:0048854 brain morphogenesis GO:0002121 inter-male aggressive behavior GO:0008360 regulation of cell shape GO:0042675 compound eye cone cell differentiation GO:0048053 R1/R6 development GO:0048750 compound eye corneal lens morphogenesis |
| InterPro families | IPR015880 Zinc finger, C2H2-like IPR007087 Zinc finger, C2H2-type IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding |
| Orthology group | MCL18913 |
Nucleotide sequence:
ATGTCTGTTAGGGGCCTCAATCTGTTCAGATACGCCTCCGTCAACGAGGGCGTATATAAA
TGCATTGAATGCGCGAAAGAGAACATACAGAAGACCTTCAAAAATAAGTATTCATTCCAG
AGACACGCCTTCCTCTACCACGAGGGTCAGCAGAGAAAAGTGTTTCCCTGTCCCGTCTGC
TGTAAGGAATTCTCGAGGCCGGATAAGATGAAGAACCACATGAAGACAACACACGACTGC
TACGTGCCGAAGGATTGCGTGTATCCGCCGAACGCTTTCTTCATGCTGCCAGGTATGGAG
GGCCAGCTGCCTCCCGCTATCACGTTAGAGGCCATCGGTTCTGGATCGCCGCGTGGCTCG
ACTCCATCCCACTCCTCACCCGATCCAACGCAAGCTTGA
Protein sequence:
MSVRGLNLFRYASVNEGVYKCIECAKENIQKTFKNKYSFQRHAFLYHEGQQRKVFPCPVC
CKEFSRPDKMKNHMKTTHDCYVPKDCVYPPNAFFMLPGMEGQLPPAITLEAIGSGSPRGS
TPSHSSPDPTQA