| New model in OGS2.0 | DPOGS211011 |
|---|---|
| Genomic Position | scaffold711:+ 36286-36871 |
| See gene structure | |
| CDS Length | 300 |
| Paired RNAseq reads | 4 |
| Single RNAseq reads | 29 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006494 (1e-33) |
| Best Drosophila hit | fruitless, isoform B (2e-27) |
| Best Human hit | ND |
| Best NR hit (blastp) | fruitless, isoform B [Drosophila melanogaster] (9e-27) |
| Best NR hit (blastx) | GA27179 [Drosophila pseudoobscura pseudoobscura] (4e-27) |
| GeneOntology terms | GO:0016545 male courtship behavior, veined wing vibration GO:0008049 male courtship behavior GO:0007618 mating GO:0003700 sequence-specific DNA binding transcription factor activity GO:0045433 male courtship behavior, veined wing generated song production GO:0007517 muscle organ development GO:0007530 sex determination GO:0007275 multicellular organismal development GO:0005634 nucleus GO:0003702 RNA polymerase II transcription factor activity GO:0007617 mating behavior GO:0016543 male courtship behavior, orientation prior to leg tapping and wing vibration GO:0007620 copulation GO:0007417 central nervous system development GO:0046661 male sex differentiation GO:0048047 mating behavior, sex discrimination GO:0005515 protein binding GO:0008270 zinc ion binding GO:0005622 intracellular GO:0002118 aggressive behavior |
| InterPro families | IPR003656 Zinc finger, BED-type predicted IPR007087 Zinc finger, C2H2-type IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding |
| Orthology group | MCL19694 |
Nucleotide sequence:
ATGCTTCTAGTTGAATTCATCATCATCTATACATGGTGCATGAGAAAAGATAGCGTAGCA
ACTGAAAAACGCGGTCCCGCACAATACTCCTACCACAGCATGTTCGTTGCGGCGGCTGAC
AGCGCCGCCTTATGGCGTTGCAAGTCATGCGGCAAGGAGGTGTCCAACCGCTGGCACCAC
TACCACTCTCACACCGCCCAACGATCTCTCTGCCCCTACTGCCCCGCTACATACAGCCGC
ATCGACACACTGAGATCTCATCTCCGCAACAAACACACCGCTCTGCTGCTCAAACACTAA
Protein sequence:
MLLVEFIIIYTWCMRKDSVATEKRGPAQYSYHSMFVAAADSAALWRCKSCGKEVSNRWHH
YHSHTAQRSLCPYCPATYSRIDTLRSHLRNKHTALLLKH