DPOGS207367 | ||
---|---|---|
Transcript | DPOGS207367-TA | 141 bp |
Protein | DPOGS207367-PA | 46 aa |
Genomic position | DPSCF303997 + 229-369 | |
RNAseq coverage | 4x (Rank: top 89%) |
Annotation | ||||
---|---|---|---|---|
Heliconius | HMEL002646 | 5e-19 | 97.78% |   |
Bombyx | BGIBMGA012562-TA | 1e-17 | 97.83% |   |
Drosophila | nAcRalpha-80B-PC | 2e-16 | 97.78% |   |
EBI UniRef50 | UniRef50_E2AGD5 | 3e-15 | 97.83% | Acetylcholine receptor subunit alpha-like n=1 Tax=Camponotus floridanus RepID=E2AGD5_CAMFO |
NCBI RefSeq | XP_002060224.1 | 3e-15 | 97.78% | GJ22507 [Drosophila virilis] |
NCBI nr blastp | gi|307178952 | 1e-14 | 97.83% | Acetylcholine receptor subunit alpha-like [Camponotus floridanus] |
NCBI nr blastx | gi|307178952 | 2e-15 | 97.83% | Acetylcholine receptor subunit alpha-like [Camponotus floridanus] |
Group | ||||
---|---|---|---|---|
Gene Ontology | GO:0016021 | 2.3e-21 | integral to membrane | |
GO:0006811 | 2.3e-21 | ion transport | ||
GO:0016020 | 8.2e-12 | membrane | ||
KEGG pathway |   | |||
InterPro domain | [1-45] IPR006201 | 2.3e-21 | Neurotransmitter-gated ion-channel | |
[1-44] IPR006029 | 8.2e-12 | Neurotransmitter-gated ion-channel transmembrane domain | ||
Orthology group |   |
Genotypes for resequenced monarchs and outgroup Danaus species |
---|
>DPOGS207367-TA
GTCACTCTCTCAATATCGATTCTTATCAGTCTCCACGTGTTCTTCCTTCTTGTGGTGGACATCATACCGCCAACGTCTCTGGTAGTACCCCTTCTTGGAAAATATCTCATCTTTGCAATGATACTGGTTTCAATAAGGTAA
>DPOGS207367-PA
VTLSISILISLHVFFLLVVDIIPPTSLVVPLLGKYLIFAMILVSIR-