| DPOGS207367 | ||
|---|---|---|
| Transcript | DPOGS207367-TA | 141 bp |
| Protein | DPOGS207367-PA | 46 aa |
| Genomic position | DPSCF303997 + 229-369 | |
| RNAseq coverage | 4x (Rank: top 89%) | |
| Annotation | ||||
|---|---|---|---|---|
| Heliconius | HMEL002646 | 5e-19 | 97.78% | |
| Bombyx | BGIBMGA012562-TA | 1e-17 | 97.83% | |
| Drosophila | nAcRalpha-80B-PC | 2e-16 | 97.78% | |
| EBI UniRef50 | UniRef50_E2AGD5 | 3e-15 | 97.83% | Acetylcholine receptor subunit alpha-like n=1 Tax=Camponotus floridanus RepID=E2AGD5_CAMFO |
| NCBI RefSeq | XP_002060224.1 | 3e-15 | 97.78% | GJ22507 [Drosophila virilis] |
| NCBI nr blastp | gi|307178952 | 1e-14 | 97.83% | Acetylcholine receptor subunit alpha-like [Camponotus floridanus] |
| NCBI nr blastx | gi|307178952 | 2e-15 | 97.83% | Acetylcholine receptor subunit alpha-like [Camponotus floridanus] |
| Group | ||||
|---|---|---|---|---|
| Gene Ontology | GO:0016021 | 2.3e-21 | integral to membrane | |
| GO:0006811 | 2.3e-21 | ion transport | ||
| GO:0016020 | 8.2e-12 | membrane | ||
| KEGG pathway | ||||
| InterPro domain | [1-45] IPR006201 | 2.3e-21 | Neurotransmitter-gated ion-channel | |
| [1-44] IPR006029 | 8.2e-12 | Neurotransmitter-gated ion-channel transmembrane domain | ||
| Orthology group | ||||
| Genotypes for resequenced monarchs and outgroup Danaus species |
|---|
>DPOGS207367-TA
GTCACTCTCTCAATATCGATTCTTATCAGTCTCCACGTGTTCTTCCTTCTTGTGGTGGACATCATACCGCCAACGTCTCTGGTAGTACCCCTTCTTGGAAAATATCTCATCTTTGCAATGATACTGGTTTCAATAAGGTAA
>DPOGS207367-PA
VTLSISILISLHVFFLLVVDIIPPTSLVVPLLGKYLIFAMILVSIR-