| New model in OGS2.0 | DPOGS210423 |
|---|---|
| Genomic Position | scaffold345:- 28723-29413 |
| See gene structure | |
| CDS Length | 240 |
| Paired RNAseq reads | 11 |
| Single RNAseq reads | 633 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA008650 (1e-22) |
| Best Drosophila hit | Cyclin-dependent kinase subunit 30A (6e-29) |
| Best Human hit | cyclin-dependent kinases regulatory subunit 1 (2e-25) |
| Best NR hit (blastp) | PREDICTED: similar to CDC28 protein kinase 1-like protein [Tribolium castaneum] (5e-31) |
| Best NR hit (blastx) | PREDICTED: similar to CDC28 protein kinase 1-like protein [Tribolium castaneum] (5e-30) |
| GeneOntology terms | GO:0006468 protein amino acid phosphorylation GO:0004693 cyclin-dependent protein kinase activity GO:0005515 protein binding GO:0016538 cyclin-dependent protein kinase regulator activity GO:0004674 protein serine/threonine kinase activity GO:0045842 positive regulation of mitotic metaphase/anaphase transition GO:0051225 spindle assembly GO:0007488 histoblast morphogenesis GO:0007049 cell cycle GO:0035186 syncytial blastoderm mitotic cell cycle GO:0007057 spindle assembly involved in female meiosis I GO:0007144 female meiosis I GO:0007143 female meiosis GO:0008054 cyclin catabolic process |
| InterPro families | IPR000789 Cyclin-dependent kinase, regulatory subunit |
| Orthology group | MCL17359 |
Nucleotide sequence:
ATGTCTAGGGATATTTACTATTCCGAAAAATATTACGACGAAGAACATGAATACAGGCAC
GTCGTATTGCCAAAAGAGATGGTGAAGTTAGTGCCTAAAAACCATTTGATGTCGGAGCAG
GAGTGGCGAGGTATAGGTGTGCAGCAAAGTCAAGGATGGGTGCACTACATGACACATCAA
CCTGAACCCCATATCCTTCTTTTCCGAAGAAAGAAGACGACTCCACCAGAGAAAAAGTAA
Protein sequence:
MSRDIYYSEKYYDEEHEYRHVVLPKEMVKLVPKNHLMSEQEWRGIGVQQSQGWVHYMTHQ
PEPHILLFRRKKTTPPEKK