| New model in OGS2.0 | DPOGS210325 |
|---|---|
| Genomic Position | scaffold160:- 326847-327859 |
| See gene structure | |
| CDS Length | 114 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 37 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | ND |
| Best Drosophila hit | CG7220, isoform C (2e-15) |
| Best Human hit | probable ubiquitin-conjugating enzyme E2 W isoform 2 (2e-15) |
| Best NR hit (blastp) | PREDICTED: similar to AGAP005324-PB [Tribolium castaneum] (9e-14) |
| Best NR hit (blastx) | PREDICTED: similar to CG7220 CG7220-PA [Acyrthosiphon pisum] (9e-16) |
| GeneOntology terms | GO:0019787 small conjugating protein ligase activity GO:0043687 post-translational protein modification GO:0051246 regulation of protein metabolic process |
| InterPro families | ND |
| Orthology group | ND |
Nucleotide sequence:
ATGCTCAGTAGCTGTAAGGAGAAGAAACGGCCGCCGGATAATTCGTTTTACGTTAAGACA
TGCAACAAAAACCCCAAAAAAACGAAATGGTGGTACCATGATGATTCAGTTTAA
Protein sequence:
MLSSCKEKKRPPDNSFYVKTCNKNPKKTKWWYHDDSV