DPGLEAN01442 in OGS1.0

New model in OGS2.0DPOGS204182 
Genomic Positionscaffold1124:+ 85718-91052
See gene structure
CDS Length330
Paired RNAseq reads  3
Single RNAseq reads  34
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitND
Best Drosophila hit  doublesex, isoform C (9e-21)
Best Human hitND
Best NR hit (blastp)  female-specific doublesex isoform F1 [Antheraea mylitta] (3e-46)
Best NR hit (blastx)  female-specific doublesex isoform F1 [Antheraea mylitta] (1e-43)
GeneOntology terms








































  
GO:0007283 spermatogenesis
GO:0019101 female somatic sex determination
GO:0005634 nucleus
GO:0007530 sex determination
GO:0003704 specific RNA polymerase II transcription factor activity
GO:0018993 somatic sex determination
GO:0008270 zinc ion binding
GO:0006366 transcription from RNA polymerase II promoter
GO:0003677 DNA binding
GO:0007548 sex differentiation
GO:0003700 sequence-specific DNA binding transcription factor activity
GO:0007619 courtship behavior
GO:0045433 male courtship behavior, veined wing generated song production
GO:0003702 RNA polymerase II transcription factor activity
GO:0007486 imaginal disc-derived female genitalia development
GO:0035215 genital disc development
GO:0007485 imaginal disc-derived male genitalia development
GO:0019102 male somatic sex determination
GO:0008049 male courtship behavior
GO:0045497 female analia development
GO:0035263 genital disc sexually dimorphic development
GO:0045496 male analia development
GO:0045498 sex comb development
GO:0046660 female sex differentiation
GO:0048071 sex-specific pigmentation
GO:0007417 central nervous system development
GO:0003729 mRNA binding
GO:0045893 positive regulation of transcription, DNA-dependent
GO:0045892 negative regulation of transcription, DNA-dependent
GO:0048086 negative regulation of developmental pigmentation
GO:0045944 positive regulation of transcription from RNA polymerase II promoter
GO:0045570 regulation of imaginal disc growth
GO:0007483 genital disc morphogenesis
GO:0000122 negative regulation of transcription from RNA polymerase II promoter
GO:0007610 behavior
GO:0006355 regulation of transcription, DNA-dependent
GO:0046661 male sex differentiation
GO:0030528 transcription regulator activity
GO:0045449 regulation of transcription
GO:0000398 nuclear mRNA splicing, via spliceosome
GO:0042803 protein homodimerization activity
GO:0005515 protein binding
InterPro families  IPR014932 Doublesex dimerisation
Orthology groupND

Nucleotide sequence:

ATGCTGAGCAAAGGCCTCTTCTCACATAGAGAAGCGTTTTCACTGGAGTCTTTGGTGGAG
AACTGTCATAAGCTGCTGGAGATGTTCCACTACTCCTGGGAGATGATGCCACTGGTGCTG
GTCATCCTGAACTACGCTGGCAGCGACCTCCAGGAGGCTGCCAGGAAGATCGACGAAGGG
AAGATGATTATCAACGAATACGCCAGGAAACATAATCTGAACATATTCGATGGGCACGAG
CTACGGAACTCGACTCGACAGAAAATGCTGAGCGAAATTAATAATATAAGTGGTGTACTG
TCATCGTCCATGAAGTTGTTTTGCGAATGA

Protein sequence:

MLSKGLFSHREAFSLESLVENCHKLLEMFHYSWEMMPLVLVILNYAGSDLQEAARKIDEG
KMIINEYARKHNLNIFDGHELRNSTRQKMLSEINNISGVLSSSMKLFCE