New model in OGS2.0 | DPOGS204182  |
---|---|
Genomic Position | scaffold1124:+ 85718-91052 |
See gene structure | |
CDS Length | 330 |
Paired RNAseq reads   | 3 |
Single RNAseq reads   | 34 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | ND |
Best Drosophila hit   | doublesex, isoform C (9e-21) |
Best Human hit | ND |
Best NR hit (blastp)   | female-specific doublesex isoform F1 [Antheraea mylitta] (3e-46) |
Best NR hit (blastx)   | female-specific doublesex isoform F1 [Antheraea mylitta] (1e-43) |
GeneOntology terms    | GO:0007283 spermatogenesis GO:0019101 female somatic sex determination GO:0005634 nucleus GO:0007530 sex determination GO:0003704 specific RNA polymerase II transcription factor activity GO:0018993 somatic sex determination GO:0008270 zinc ion binding GO:0006366 transcription from RNA polymerase II promoter GO:0003677 DNA binding GO:0007548 sex differentiation GO:0003700 sequence-specific DNA binding transcription factor activity GO:0007619 courtship behavior GO:0045433 male courtship behavior, veined wing generated song production GO:0003702 RNA polymerase II transcription factor activity GO:0007486 imaginal disc-derived female genitalia development GO:0035215 genital disc development GO:0007485 imaginal disc-derived male genitalia development GO:0019102 male somatic sex determination GO:0008049 male courtship behavior GO:0045497 female analia development GO:0035263 genital disc sexually dimorphic development GO:0045496 male analia development GO:0045498 sex comb development GO:0046660 female sex differentiation GO:0048071 sex-specific pigmentation GO:0007417 central nervous system development GO:0003729 mRNA binding GO:0045893 positive regulation of transcription, DNA-dependent GO:0045892 negative regulation of transcription, DNA-dependent GO:0048086 negative regulation of developmental pigmentation GO:0045944 positive regulation of transcription from RNA polymerase II promoter GO:0045570 regulation of imaginal disc growth GO:0007483 genital disc morphogenesis GO:0000122 negative regulation of transcription from RNA polymerase II promoter GO:0007610 behavior GO:0006355 regulation of transcription, DNA-dependent GO:0046661 male sex differentiation GO:0030528 transcription regulator activity GO:0045449 regulation of transcription GO:0000398 nuclear mRNA splicing, via spliceosome GO:0042803 protein homodimerization activity GO:0005515 protein binding |
InterPro families   | IPR014932 Doublesex dimerisation |
Orthology group | ND |
Nucleotide sequence:
ATGCTGAGCAAAGGCCTCTTCTCACATAGAGAAGCGTTTTCACTGGAGTCTTTGGTGGAG
AACTGTCATAAGCTGCTGGAGATGTTCCACTACTCCTGGGAGATGATGCCACTGGTGCTG
GTCATCCTGAACTACGCTGGCAGCGACCTCCAGGAGGCTGCCAGGAAGATCGACGAAGGG
AAGATGATTATCAACGAATACGCCAGGAAACATAATCTGAACATATTCGATGGGCACGAG
CTACGGAACTCGACTCGACAGAAAATGCTGAGCGAAATTAATAATATAAGTGGTGTACTG
TCATCGTCCATGAAGTTGTTTTGCGAATGA
Protein sequence:
MLSKGLFSHREAFSLESLVENCHKLLEMFHYSWEMMPLVLVILNYAGSDLQEAARKIDEG
KMIINEYARKHNLNIFDGHELRNSTRQKMLSEINNISGVLSSSMKLFCE