| New model in OGS2.0 | DPOGS212091 |
|---|---|
| Genomic Position | scaffold4075:- 3785-7985 |
| See gene structure | |
| CDS Length | 486 |
| Paired RNAseq reads | 188 |
| Single RNAseq reads | 1006 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006725 (2e-83) |
| Best Drosophila hit | rolled, isoform B (5e-79) |
| Best Human hit | mitogen-activated protein kinase 1 (1e-77) |
| Best NR hit (blastp) | extracellular regulated MAP kinase [Bombyx mori] (1e-85) |
| Best NR hit (blastx) | extracellular regulated MAP kinase [Bombyx mori] (2e-84) |
| GeneOntology terms | GO:0004707 MAP kinase activity GO:0005634 nucleus GO:0005737 cytoplasm GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway GO:0004705 JUN kinase activity GO:0007369 gastrulation GO:0008595 anterior/posterior axis specification, embryo GO:0008293 torso signaling pathway GO:0000165 MAPKKK cascade GO:0006468 protein amino acid phosphorylation GO:0006355 regulation of transcription, DNA-dependent GO:0045467 R7 cell development GO:0004674 protein serine/threonine kinase activity GO:0006916 anti-apoptosis GO:0007507 heart development GO:0045500 sevenless signaling pathway GO:0007173 epidermal growth factor receptor signaling pathway GO:0050803 regulation of synapse structure and activity GO:0005524 ATP binding GO:0007474 imaginal disc-derived wing vein specification GO:0007067 mitosis GO:0007476 imaginal disc-derived wing morphogenesis GO:0046534 positive regulation of photoreceptor cell differentiation GO:0005515 protein binding GO:0030054 cell junction GO:0034334 adherens junction maintenance GO:0050804 regulation of synaptic transmission GO:0048149 behavioral response to ethanol GO:0006974 response to DNA damage stimulus GO:0007552 metamorphosis |
| InterPro families | IPR002290 Serine/threonine-protein kinase domain IPR020635 Tyrosine-protein kinase, catalytic domain IPR017442 Serine/threonine-protein kinase-like domain IPR008271 Serine/threonine-protein kinase, active site IPR003527 MAP kinase, conserved site IPR000719 Protein kinase, catalytic domain IPR011009 Protein kinase-like domain IPR008349 ERK1/2 MAP kinase |
| Orthology group | MCL13150 |
Nucleotide sequence:
ATGAAGCTAGCTAAAGTCGCCATTAAGAAAATATCACCTTTCGAACACCAGACTTACTGT
CAGAGGACGCTTAGGGAAATCAAGATTCTGACACGATTTAAGCATGAGAATATAATTGAT
ATTAGAGATATTTTAAGAGCCGAAACAATCGATCAAATGAAGGACGTCTACATCGTCCAG
TGTTTGATGGAGACGGATCTTTATAAGTTATTAAAAACACAAAAATTAAGTAACGATCAC
ATCTGCTACTTCCTGTATCAAATCCTGCGAGGTTTGAAGTACATACACTCGGCCAACGTG
CTCCACCGCGACCTCAAACCGTCTAACCTGCTCCTCAACACCACCTGTGACCTAAAGATA
TGTGACTTTGGTCTGGCTCGCGTGGCCGACCCTGATCATGACCACACAGGCTTCCTCACG
GAGTACGTCGCAACACGCTGGTATCGTGCACCAGAGATCATGCTGATGAGCTTCCATAAC
ATATAG
Protein sequence:
MKLAKVAIKKISPFEHQTYCQRTLREIKILTRFKHENIIDIRDILRAETIDQMKDVYIVQ
CLMETDLYKLLKTQKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKI
CDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLMSFHNI