New model in OGS2.0 | DPOGS210795 |
---|---|
Genomic Position | scaffold1772:- 28221-34002 |
See gene structure | |
CDS Length | 558 |
Paired RNAseq reads | 417 |
Single RNAseq reads | 2947 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA007110 (1e-85) |
Best Drosophila hit | Rac1 (2e-85) |
Best Human hit | ras-related C3 botulinum toxin substrate 1 isoform Rac1 (5e-84) |
Best NR hit (blastp) | PREDICTED: similar to Ras-related protein Rac1 isoform 1 [Apis mellifera] (9e-97) |
Best NR hit (blastx) | PREDICTED: similar to Ras-related protein Rac1 isoform 1 [Apis mellifera] (1e-95) |
GeneOntology terms | GO:0035320 imaginal disc-derived wing hair site selection GO:0003924 GTPase activity GO:0007391 dorsal closure GO:0007254 JNK cascade GO:0007409 axonogenesis GO:0007520 myoblast fusion GO:0030707 ovarian follicle cell development GO:0008283 cell proliferation GO:0051963 regulation of synaptogenesis GO:0031175 neuron projection development GO:0030036 actin cytoskeleton organization GO:0016028 rhabdomere GO:0042052 rhabdomere development GO:0046843 dorsal appendage formation GO:0046664 dorsal closure, amnioserosa morphology change GO:0007017 microtubule-based process GO:0016335 morphogenesis of larval imaginal disc epithelium GO:0007164 establishment of tissue polarity GO:0042067 establishment of ommatidial planar polarity GO:0045216 cell-cell junction organization GO:0007411 axon guidance GO:0007424 open tracheal system development GO:0007426 tracheal outgrowth, open tracheal system GO:0007422 peripheral nervous system development GO:0008347 glial cell migration GO:0048813 dendrite morphogenesis GO:0050807 regulation of synapse organization GO:0048814 regulation of dendrite morphogenesis GO:0007264 small GTPase mediated signal transduction GO:0005622 intracellular GO:0005525 GTP binding GO:0050770 regulation of axonogenesis GO:0045610 regulation of hemocyte differentiation GO:0035099 hemocyte migration GO:0007419 ventral cord development GO:0007413 axonal fasciculation GO:0051450 myoblast proliferation GO:0048747 muscle fiber development GO:0007390 germ-band shortening GO:0008258 head involution GO:0051017 actin filament bundle assembly GO:0007394 dorsal closure, elongation of leading edge cells GO:0030032 lamellipodium assembly GO:0007298 border follicle cell migration GO:0007015 actin filament organization GO:0007435 salivary gland morphogenesis GO:0006911 phagocytosis, engulfment GO:0048675 axon extension GO:0007516 hemocyte development GO:0002433 phagocytosis triggered by activation of immune response cell surface activating receptor GO:0035212 cell competition in a multicellular organism GO:0034334 adherens junction maintenance GO:0006974 response to DNA damage stimulus GO:0010593 negative regulation of lamellipodium assembly |
InterPro families | IPR003577 Ras small GTPase, Ras type IPR003578 Small GTPase, Rho type IPR003579 Ras small GTPase, Rab type IPR005225 Small GTP-binding protein IPR013753 Ras IPR001806 Ras GTPase |
Orthology group | MCL11325 |
Nucleotide sequence:
ATGAACACCATAAGTGCCGTCGGTAAGACATGTCTGCTCATCAGTTATACTACAAATGCC
TTCCCCGGCGAGTACATACCGACAGTATTCGATAATTATTCAGCAAATGTGATGGTCGAT
GGCAAGCCAATCAACCTCGGGCTTTGGGACACGGCTGGTCAGGAGGACTACGACAGGTTG
CGACCCCTGTCCTATCCACAGACGGACGTCTTCCTCATATGCTTCTCACTCGTCAACCCA
GCTTCCTTCGAGAACGTTCGCGCTAAGTGGTATCCGGAGGTGAGGCATCATTGTCCCTCG
ACTCCCATCATCCTGGTTGGAACTAAGCTCGACCTCCGCGAGGACAAGGACACCATAGAG
AAGCTCAAGGACAAGAAACTGGCCGCCATCACCTACCCTCAGGGTCTCAGCATGGCTAAG
GAGATAGGCGCGGTGAAGTACCTCGAGTGCTCCGCCCTCACGCAGAAGGGTTTGAAGACT
GTGTTCGACGAGGCCATCCGAGCTGTGCTCTGTCCGGTGCAGCCCGTCAAGGTCAAGCGG
AAGTGCGTCCTACTCTAA
Protein sequence:
MNTISAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRL
RPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLREDKDTIE
KLKDKKLAAITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPVQPVKVKR
KCVLL