| New model in OGS2.0 | DPOGS212092 |
|---|---|
| Genomic Position | scaffold8549:+ 2674-2859 |
| See gene structure | |
| CDS Length | 186 |
| Paired RNAseq reads | 5 |
| Single RNAseq reads | 268 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006725 (3e-31) |
| Best Drosophila hit | rolled, isoform B (6e-28) |
| Best Human hit | mitogen-activated protein kinase 3 isoform 1 (2e-29) |
| Best NR hit (blastp) | extracellular regulated MAP kinase [Bombyx mori] (1e-28) |
| Best NR hit (blastx) | extracellular regulated MAP kinase [Bombyx mori] (2e-26) |
| GeneOntology terms | GO:0000165 MAPKKK cascade GO:0000166 nucleotide binding GO:0000189 nuclear translocation of MAPK GO:0001784 phosphotyrosine binding GO:0004672 protein kinase activity GO:0004674 protein serine/threonine kinase activity GO:0004707 MAP kinase activity GO:0005515 protein binding GO:0005524 ATP binding GO:0005625 soluble fraction GO:0005626 insoluble fraction GO:0005634 nucleus GO:0005654 nucleoplasm GO:0005737 cytoplasm GO:0005829 cytosol GO:0006461 protein complex assembly GO:0006468 protein amino acid phosphorylation GO:0006974 response to DNA damage stimulus GO:0007049 cell cycle GO:0007165 signal transduction GO:0007243 intracellular protein kinase cascade GO:0007264 small GTPase mediated signal transduction GO:0007265 Ras protein signal transduction GO:0009636 response to toxin GO:0009887 organ morphogenesis GO:0015630 microtubule cytoskeleton GO:0016301 kinase activity GO:0016310 phosphorylation GO:0016740 transferase activity GO:0019233 sensory perception of pain GO:0023034 intracellular signaling pathway GO:0030528 transcription regulator activity GO:0031663 lipopolysaccharide-mediated signaling pathway GO:0032496 response to lipopolysaccharide GO:0043234 protein complex GO:0043330 response to exogenous dsRNA GO:0045727 positive regulation of translation GO:0045941 positive regulation of transcription GO:0051090 regulation of transcription factor activity GO:0051216 cartilage development GO:0005730 nucleolus |
| InterPro families | IPR017442 Serine/threonine-protein kinase-like domain IPR011009 Protein kinase-like domain IPR000719 Protein kinase, catalytic domain IPR008349 ERK1/2 MAP kinase |
| Orthology group | ND |
Nucleotide sequence:
GGATACACAAAGTCGATAGACATCTGGTCGGTGGGCTGTATCCTGGCGGAAATGCTGTCC
AATCGGCCGATATTCCCCGGGAAGCATTACCTGGACCAACTGAACCACATTCTGGGCGTG
CTAGGTTCTCCAAGCCAGGAAGACCTAGACTGCATTATCAATGAAAAGGTGAGGTGTTGT
CTATAA
Protein sequence:
GYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQEDLDCIINEKVRCC
L