| New model in OGS2.0 | DPOGS215932 |
|---|---|
| Genomic Position | scaffold2568:- 11869-12611 |
| See gene structure | |
| CDS Length | 618 |
| Paired RNAseq reads | 4775 |
| Single RNAseq reads | 13652 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA001966 (4e-113) |
| Best Drosophila hit | Rho1, isoform D (1e-99) |
| Best Human hit | transforming protein RhoA precursor (1e-90) |
| Best NR hit (blastp) | Ras-like GTP-binding protein Rho1 [Tribolium castaneum] (3e-105) |
| Best NR hit (blastx) | AGAP005160-PA [Anopheles gambiae str. PEST] (3e-106) |
| GeneOntology terms | GO:0007377 germ-band extension GO:0007370 ventral furrow formation GO:0010004 gastrulation involving germ band extension GO:0007374 posterior midgut invagination GO:0003924 GTPase activity GO:0007369 gastrulation GO:0016318 ommatidial rotation GO:0007254 JNK cascade GO:0007391 dorsal closure GO:0001737 establishment of imaginal disc-derived wing hair orientation GO:0005515 protein binding GO:0007405 neuroblast proliferation GO:0035317 imaginal disc-derived wing hair organization GO:0019900 kinase binding GO:0030036 actin cytoskeleton organization GO:0030239 myofibril assembly GO:0016203 muscle attachment GO:0035149 lumen formation, open tracheal system GO:0046664 dorsal closure, amnioserosa morphology change GO:0007010 cytoskeleton organization GO:0007164 establishment of tissue polarity GO:0000910 cytokinesis GO:0007349 cellularization GO:0007395 dorsal closure, spreading of leading edge cells GO:0046663 dorsal closure, leading edge cell differentiation GO:0042060 wound healing GO:0051017 actin filament bundle assembly GO:0007411 axon guidance GO:0008045 motor axon guidance GO:0016055 Wnt receptor signaling pathway GO:0001736 establishment of planar polarity GO:0007422 peripheral nervous system development GO:0008347 glial cell migration GO:0048813 dendrite morphogenesis GO:0007015 actin filament organization GO:0007264 small GTPase mediated signal transduction GO:0005525 GTP binding GO:0008354 germ cell migration GO:0035147 branch fusion, open tracheal system GO:0050770 regulation of axonogenesis GO:0006897 endocytosis GO:0035099 hemocyte migration GO:0035298 regulation of Malpighian tubule size GO:0007424 open tracheal system development GO:0005938 cell cortex GO:0045184 establishment of protein localization GO:0035277 spiracle morphogenesis, open tracheal system GO:0007173 epidermal growth factor receptor signaling pathway GO:0001745 compound eye morphogenesis GO:0007368 determination of left/right symmetry GO:0045199 maintenance of epithelial cell apical/basal polarity GO:0016476 regulation of embryonic cell shape GO:0007435 salivary gland morphogenesis GO:0030589 pseudocleavage involved in syncytial blastoderm formation GO:0090254 cell elongation involved in imaginal disc-derived wing morphogenesis GO:0006974 response to DNA damage stimulus GO:0005737 cytoplasm GO:0070451 cell hair GO:0035159 regulation of tube length, open tracheal system |
| InterPro families | IPR003578 Small GTPase, Rho type IPR005225 Small GTP-binding protein IPR003577 Ras small GTPase, Ras type IPR003579 Ras small GTPase, Rab type IPR002041 Ran GTPase IPR013753 Ras IPR001806 Ras GTPase |
| Orthology group | MCL15321 |
Nucleotide sequence:
ATGTGGTGGTGCTGTTCTTCTTCCGCTAGTTCAGGACCGATGGCTGCGATACGCAAAAAA
TTAGTGATTGTTGGTGATGGTGCATGCGGTAAAACATGCCTGTTAATTGTATTTAGCAAA
GATCAGTTCCCGGAAGTGTATGTGCCGACAGTGTTCGAAAACTACGTTGCCGACATCGAG
GTTGACGGCAAACAGGTGGAATTAGCCTTATGGGATACAGCCGGTCAGGAAGATTACGAT
CGACTGAGGCCACTCTCGTACCCCGACACCGATGTGATCCTCATGTGCTTCTCGGTGGAC
TCGCCGGACTCGCTCGAGAACATCCCGGAGAAGTGGACACCCGAGGTGAAACACTTCTGC
CCTAATGTGCCTATAATCCTGGTGGGCAACAAGAAGGATCTGCGTAACGACCCGGCCACT
ATCAACGAGCTGCGCAAGATGAAGCAGGAGCCTGTGAAGCCTCAGGAAGGTCGTGCTATG
GCTGAGAAGATCAATGCCTTCGCATACCTCGAGTGCTCTGCTAAAAGCAAGGAGGGTGTG
CGCGAAGTGTTCGAGACGGCCACCCGTGCCGCGTTACAAGTCAAGAAGAAGAAGAAGACT
AGGTGTTCTCTGCTGTAA
Protein sequence:
MWWCCSSSASSGPMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIE
VDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFC
PNVPIILVGNKKDLRNDPATINELRKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGV
REVFETATRAALQVKKKKKTRCSLL