DPGLEAN07088 in OGS1.0

New model in OGS2.0DPOGS202058 
Genomic Positionscaffold356:- 113945-120716
See gene structure
CDS Length456
Paired RNAseq reads  12
Single RNAseq reads  264
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA012534 (1e-43)
Best Drosophila hit  hedgehog, isoform B (1e-22)
Best Human hitsonic hedgehog protein preproprotein (3e-24)
Best NR hit (blastp)  hedgehog protein [Daphnia magna] (1e-27)
Best NR hit (blastx)  hedgehog [Tribolium castaneum] (3e-29)
GeneOntology terms






















































































































































































  		GO:0060425 lung morphogenesis
GO:0060428 lung epithelium development
GO:0010463 mesenchymal cell proliferation
GO:0060174 limb bud formation
GO:0010628 positive regulation of gene expression
GO:0060173 limb development
GO:0010553 negative regulation of gene-specific transcription from RNA polymerase II promoter
GO:0010552 positive regulation of gene-specific transcription from RNA polymerase II promoter
GO:0048839 inner ear development
GO:0060438 trachea development
GO:0060021 palate development
GO:0021521 ventral spinal cord interneuron specification
GO:0014706 striated muscle tissue development
GO:0014902 myotube differentiation
GO:0014858 positive regulation of skeletal muscle cell proliferation
GO:0060070 canonical Wnt receptor signaling pathway
GO:0060442 branching involved in prostate gland morphogenesis
GO:0048808 male genitalia morphogenesis
GO:0060406 positive regulation of penile erection
GO:0021938 smoothened signaling pathway involved in regulation of granule cell precursor cell proliferation
GO:0060020 Bergmann glial cell differentiation
GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0002052 positive regulation of neuroblast proliferation
GO:0021904 dorsal/ventral neural tube patterning
GO:0021978 telencephalon regionalization
GO:0014003 oligodendrocyte development
GO:0070447 positive regulation of oligodendrocyte progenitor proliferation
GO:0048864 stem cell development
GO:0021940 positive regulation of granule cell precursor proliferation
GO:0048856 anatomical structure development
GO:0021513 spinal cord dorsal/ventral patterning
GO:0002076 osteoblast development
GO:0010468 regulation of gene expression
GO:0048859 formation of anatomical boundary
GO:0002053 positive regulation of mesenchymal cell proliferation
GO:0060439 trachea morphogenesis
GO:0060441 epithelial tube branching involved in lung morphogenesis
GO:0060463 lung lobe morphogenesis
GO:0060458 right lung development
GO:0060484 lung-associated mesenchyme development
GO:0060459 left lung development
GO:0080125 multicellular structure septum development
GO:0060916 mesenchymal cell proliferation involved in lung development
GO:0060840 artery development
GO:0060445 branching involved in salivary gland morphogenesis
GO:0060664 epithelial cell proliferation involved in salivary gland morphogenesis
GO:0060516 primary prostatic bud elongation
GO:0060684 epithelial-mesenchymal cell signaling
GO:0060685 regulation of prostatic bud formation
GO:0060738 epithelial-mesenchymal signaling involved in prostate gland development
GO:0090090 negative regulation of canonical Wnt receptor signaling pathway
GO:0060513 prostatic bud formation
GO:0090041 negative regulation of gene-specific transcription elongation from RNA polymerase II promoter
GO:0060523 prostate epithelial cord elongation
GO:0060662 salivary gland cavitation
GO:0060769 positive regulation of epithelial cell proliferation involved in prostate gland development
GO:0071285 cellular response to lithium ion
GO:0072199 regulation of mesenchymal cell proliferation involved in ureter development
GO:0072193 ureter smooth muscle cell differentiation
GO:0060783 mesenchymal smoothened signaling pathway involved in prostate gland development
GO:0060768 regulation of epithelial cell proliferation involved in prostate gland development
GO:0060782 regulation of mesenchymal cell proliferation involved in prostate gland development
GO:0060447 bud outgrowth involved in lung branching
GO:0043587 tongue morphogenesis
GO:0048709 oligodendrocyte differentiation
GO:0048678 response to axon injury
GO:0048714 positive regulation of oligodendrocyte differentiation
GO:0043588 skin development
GO:0048663 neuron fate commitment
GO:0048754 branching morphogenesis of a tube
GO:0048557 embryonic digestive tract morphogenesis
GO:0048643 positive regulation of skeletal muscle tissue development
GO:0048568 embryonic organ development
GO:0048645 organ formation
GO:0031069 hair follicle morphogenesis
GO:0048706 embryonic skeletal system development
GO:0048617 embryonic foregut morphogenesis
GO:0048598 embryonic morphogenesis
GO:0048646 anatomical structure formation involved in morphogenesis
GO:0001948 glycoprotein binding
GO:0048589 developmental growth
GO:0001942 hair follicle development
GO:0001944 vasculature development
GO:0048546 digestive tract morphogenesis
GO:0001947 heart looping
GO:0016787 hydrolase activity
GO:0016020 membrane
GO:0005576 extracellular region
GO:0008233 peptidase activity
GO:0007154 cell communication
GO:0005886 plasma membrane
GO:0005515 protein binding
GO:0016563 transcription activator activity
GO:0005113 patched binding
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0030133 transport vesicle
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005624 membrane fraction
GO:0005539 glycosaminoglycan binding
GO:0042733 embryonic digit morphogenesis
GO:0043193 positive regulation of gene-specific transcription
GO:0030850 prostate gland development
GO:0001841 neural tube formation
GO:0030900 forebrain development
GO:0030902 hindbrain development
GO:0030901 midbrain development
GO:0048468 cell development
GO:0051146 striated muscle cell differentiation
GO:0043237 laminin-1 binding
GO:0031016 pancreas development
GO:0043066 negative regulation of apoptosis
GO:0051152 positive regulation of smooth muscle cell differentiation
GO:0051151 negative regulation of smooth muscle cell differentiation
GO:0051155 positive regulation of striated muscle cell differentiation
GO:0035115 embryonic forelimb morphogenesis
GO:0035116 embryonic hindlimb morphogenesis
GO:0031012 extracellular matrix
GO:0030878 thyroid gland development
GO:0001822 kidney development
GO:0048314 embryo sac morphogenesis
GO:0043010 camera-type eye development
GO:0042476 odontogenesis
GO:0045471 response to ethanol
GO:0045666 positive regulation of neuron differentiation
GO:0046534 positive regulation of photoreceptor cell differentiation
GO:0046639 negative regulation of alpha-beta T cell differentiation
GO:0042475 odontogenesis of dentine-containing tooth
GO:0009952 anterior/posterior pattern formation
GO:0045944 positive regulation of transcription from RNA polymerase II promoter
GO:0045449 regulation of transcription
GO:0045445 myoblast differentiation
GO:0042307 positive regulation of protein import into nucleus
GO:0045165 cell fate commitment
GO:0045597 positive regulation of cell differentiation
GO:0045109 intermediate filament organization
GO:0009790 embryo development
GO:0001708 cell fate specification
GO:0045596 negative regulation of cell differentiation
GO:0009953 dorsal/ventral pattern formation
GO:0009986 cell surface
GO:0045121 membrane raft
GO:0001755 neural crest cell migration
GO:0007596 blood coagulation
GO:0007275 multicellular organismal development
GO:0042127 regulation of cell proliferation
GO:0008284 positive regulation of cell proliferation
GO:0007389 pattern specification process
GO:0007267 cell-cell signaling
GO:0007165 signal transduction
GO:0007411 axon guidance
GO:0001570 vasculogenesis
GO:0030326 embryonic limb morphogenesis
GO:0007224 smoothened signaling pathway
GO:0030162 regulation of proteolysis
GO:0001569 patterning of blood vessels
GO:0007368 determination of left/right symmetry
GO:0006915 apoptosis
GO:0008283 cell proliferation
GO:0008219 cell death
GO:0007398 ectoderm development
GO:0016539 intein-mediated protein splicing
GO:0006508 proteolysis
GO:0007228 positive regulation of hh target transcription factor activity
GO:0001525 angiogenesis
GO:0001656 metanephros development
GO:0042130 negative regulation of T cell proliferation
GO:0007502 digestive tract mesoderm development
GO:0030178 negative regulation of Wnt receptor signaling pathway
GO:0007442 hindgut morphogenesis
GO:0007507 heart development
GO:0042177 negative regulation of protein catabolic process
GO:0030324 lung development
GO:0006897 endocytosis
GO:0030010 establishment of cell polarity
GO:0030336 negative regulation of cell migration
GO:0030323 respiratory tube development
GO:0008209 androgen metabolic process
GO:0030539 male genitalia development
GO:0007417 central nervous system development
GO:0007405 neuroblast proliferation
GO:0001658 branching involved in ureteric bud morphogenesis
GO:0030177 positive regulation of Wnt receptor signaling pathway
InterPro families
  		IPR009045 Hedgehog/DD-peptidase, zinc-binding motif
IPR000320 Hedgehog, N-terminal signaling domain
Orthology groupMCL19667

Nucleotide sequence:

ATGAGGCTAACGCTGGTGCTACTGTGGCTGGGCGCTGCGGCGGCCTGTGGCCCGGGCCGT
GGCTTCACCCGCCGCCACGGACCGCGCCGCATAACGCCCCTCGTCTTCAACCAGCACGAC
CCTAACATCAACGAGAACTCCAAGTCAGCCAGCGGACCCCCAGAGGGACGTATCACTAGA
AACGACGAGAAATTCAAAGACTTAGTGCCAAATTATAATCCGGATATAGACTTCAAGGAT
GAAGAGGGCACGGGTGCCGATCGGCTCATGACACAGTTTCAAAGCGACCGGCGATCGAGT
CCAGGCGCCGCGGGATGCCGGCGTGTCCCCGGGCCCCGTACCCCTTACCTTTATTTATAT
TTATTTACCTTCCCTTCATTCAACGAAGGGCCGCCCTTTCGGCCCTTTTTGTCGCCCCGA
TACAAATATTGTGAAAGAGGCCTGCGGTTGGAGTAA

Protein sequence:

MRLTLVLLWLGAAAACGPGRGFTRRHGPRRITPLVFNQHDPNINENSKSASGPPEGRITR
NDEKFKDLVPNYNPDIDFKDEEGTGADRLMTQFQSDRRSSPGAAGCRRVPGPRTPYLYLY
LFTFPSFNEGPPFRPFLSPRYKYCERGLRLE